Chymotrypsin-like protease Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33973

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: VTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLK

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (84%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Chymotrypsin-like protease Antibody - BSA Free

Western Blot: Chymotrypsin-like protease Antibody [NBP2-33973]

Western Blot: Chymotrypsin-like protease Antibody [NBP2-33973]

Western Blot: Chymotrypsin-like protease Antibody [NBP2-33973] - Analysis in control (vector only transfected HEK293T lysate) and CTRL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973]

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973]

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973] - Staining of human liver.
Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973]

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973]

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973] - staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973]

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973]

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973]

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973]

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973] - Staining of human pancreas shows high expression.
Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973]

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973]

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973] - Staining in human pancreas and colon tissues using anti-CTRL antibody. Corresponding CTRL RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973]

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973]

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973] - Staining of human cerebral cortex, liver, lymph node and pancreas using Anti-CTRL antibody NBP2-33973 (A) shows similar protein distribution across tissues to independent antibody NBP1-87520 (B).
Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973]

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973]

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973]

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973]

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP2-33973] - Staining of human lymph node.

Applications for Chymotrypsin-like protease Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Chymotrypsin-like protease

CTRL - chymotrypsin-like

Alternate Names

chymotrypsin-like, chymotrypsin-like protease CTRL-1, CTRL1, EC 3.4.21, EC 3.4.21.-, MGC70821

Gene Symbol

CTRL

UniProt

Additional Chymotrypsin-like protease Products

Product Documents for Chymotrypsin-like protease Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Chymotrypsin-like protease Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Chymotrypsin-like protease Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Chymotrypsin-like protease Antibody - BSA Free and earn rewards!

Have you used Chymotrypsin-like protease Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...