CKII alpha prime polypeptide Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35347

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-350 of human CKII alpha prime polypeptide (NP_001887.1).

Sequence:
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CKII alpha prime polypeptide Antibody - BSA Free

CKII alpha prime polypeptide Antibody

Western Blot: CKII alpha prime polypeptide Antibody [NBP3-35347] -

Western Blot: CKII alpha prime polypeptide Antibody [NBP3-35347] - Western blot analysis of various lysates using CKII alpha prime polypeptide Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
CKII alpha prime polypeptide Antibody

Immunohistochemistry: CKII alpha prime polypeptide Antibody [NBP3-35347] -

Immunohistochemistry: CKII alpha prime polypeptide Antibody [NBP3-35347] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using CKII alpha prime polypeptide Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
CKII alpha prime polypeptide Antibody

Immunocytochemistry/ Immunofluorescence: CKII alpha prime polypeptide Antibody [NBP3-35347] -

Immunocytochemistry/ Immunofluorescence: CKII alpha prime polypeptide Antibody [NBP3-35347] - Immunofluorescence analysis of NIH-3T3 cells using CKII alpha prime polypeptide Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
CKII alpha prime polypeptide Antibody

Immunohistochemistry: CKII alpha prime polypeptide Antibody [NBP3-35347] -

Immunohistochemistry: CKII alpha prime polypeptide Antibody [NBP3-35347] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using CKII alpha prime polypeptide Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
CKII alpha prime polypeptide Antibody

Immunohistochemistry: CKII alpha prime polypeptide Antibody [NBP3-35347] -

Immunohistochemistry: CKII alpha prime polypeptide Antibody [NBP3-35347] - Immunohistochemistry analysis of paraffin-embedded Mouse lung using CKII alpha prime polypeptide Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
CKII alpha prime polypeptide Antibody

Immunohistochemistry: CKII alpha prime polypeptide Antibody [NBP3-35347] -

Immunohistochemistry: CKII alpha prime polypeptide Antibody [NBP3-35347] - Immunohistochemistry analysis of paraffin-embedded Rat lung using CKII alpha prime polypeptide Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for CKII alpha prime polypeptide Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunohistochemistry-Paraffin

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CKII alpha prime polypeptide

CKII alpha is involved in leukemogensis and tumorigenesis. It is a catalytic, ubiquitous cellular kinase that can use ATP and GTP as phosphorylation donors. CKII alpha also plays a role in many proliferation-related processes in the cell.

Long Name

Casein kinase II subunit alpha'

Alternate Names

CK II alpha', CK2A2, CSNK2A2

Gene Symbol

CSNK2A2

Additional CKII alpha prime polypeptide Products

Product Documents for CKII alpha prime polypeptide Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CKII alpha prime polypeptide Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CKII alpha prime polypeptide Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CKII alpha prime polypeptide Antibody - BSA Free and earn rewards!

Have you used CKII alpha prime polypeptide Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...