CLCC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82793

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Independent Antibodies

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PPQALRPRDRRRQEEIDYRPDGGAGDADFHYRGQMGPTEQGPYAKTYEGRREILRERDVDLRFQTGNKSPEVLRAFDVPDAEAREHPTVVPSHKSPVLDTKPKE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CLCC1 Antibody - BSA Free

Immunohistochemistry-Paraffin: CLCC1 Antibody [NBP1-82793]

Immunohistochemistry-Paraffin: CLCC1 Antibody [NBP1-82793]

Immunohistochemistry-Paraffin: CLCC1 Antibody [NBP1-82793] - Staining of human cerebellum, endometrium, kidney and testis using Anti-CLCC1 antibody NBP1-82793 (A) shows similar protein distribution across tissues to independent antibody NBP1-82792 (B).
Immunocytochemistry/ Immunofluorescence: CLCC1 Antibody [NBP1-82793]

Immunocytochemistry/ Immunofluorescence: CLCC1 Antibody [NBP1-82793]

Immunocytochemistry/Immunofluorescence: CLCC1 Antibody [NBP1-82793] - Staining of human cell line U-251 MG shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CLCC1 Antibody [NBP1-82793]

Immunohistochemistry-Paraffin: CLCC1 Antibody [NBP1-82793]

Immunohistochemistry-Paraffin: CLCC1 Antibody [NBP1-82793] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: CLCC1 Antibody [NBP1-82793]

Immunohistochemistry-Paraffin: CLCC1 Antibody [NBP1-82793]

Immunohistochemistry-Paraffin: CLCC1 Antibody [NBP1-82793] - Staining of human cerebellum shows weak positivity in neuronal processes.
Immunohistochemistry-Paraffin: CLCC1 Antibody [NBP1-82793]

Immunohistochemistry-Paraffin: CLCC1 Antibody [NBP1-82793]

Immunohistochemistry-Paraffin: CLCC1 Antibody [NBP1-82793] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CLCC1 Antibody [NBP1-82793]

Immunohistochemistry-Paraffin: CLCC1 Antibody [NBP1-82793]

Immunohistochemistry-Paraffin: CLCC1 Antibody [NBP1-82793] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Knockdown Validated: CLCC1 Antibody [NBP1-82793]

Western Blot: CLCC1 Antibody [NBP1-82793]

CLCC1-Antibody-Knockdown-Validated-NBP1-82793-img0021.jpg
CLCC1 Antibody

Western Blot: CLCC1 Antibody [NBP1-82793] -

Western Blot: CLCC1 Antibody [NBP1-82793] - CLCC1 siRNA interference in ARPE19 cells.(a) Western Blot of SiRNA treated ARPE19 cell lysates probed with CLCC1 antibodies. Lane 1, untransfected lysate; lane 2, transfected with RNAi Max transfection reagent only; lanes 3–12, Increasing CLCC1 & control siRNA amounts from 10 pmol (lanes 3,4) to 70 pmol (lanes 11, 12). CLCC1 proteins migrate at the predicted MW of 67 kDa. The blot shows a dose dependent reduction of CLCC1 protein expression in CLCC1 but not control siRNA treated ARPE19 cells to about 20% of normal. (b) TUNEL assay after siRNA transfection. Left: TUNEL-positive apoptotic cells (green), Second: CLCC1 (red), Third: DAPI (blue, nucleus). Although there is some variation in intensity of individual cells, probably based on cell size, shape, & orientation, staining for CLCC1 is lower overall in the CLCC1 siRNA treated cells than the control siRNA, control, or DNase 1 cells, consistent with the Western blot in Fig 5a. About 10% of CLCC1 siRNA transfected cells were apoptotic (arrows) but there is minimal apoptosis in control siRNA or untransfected cells. DNase I treated cells were 100% TUNEL-positive. Overlays of images from the first three columns are shown in the right column labeled Merged. Scale Bar: 20 μm. (c) Down regulation of CLCC1 induced apoptosis in nearly 10% of the cells (*** P<0.0001, t = 14.63) as compared to approximately 1% of cells treated with the control siRNA & less than 1% of untreated cells. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30157172), licensed under a CC0-1.0 license. Not internally tested by Novus Biologicals.
CLCC1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CLCC1 Antibody - BSA Free [NBP1-82793] -

CLCC1 siRNA interference in ARPE19 cells.(a) Western Blot of SiRNA treated ARPE19 cell lysates probed with CLCC1 antibodies. Lane 1, untransfected lysate; lane 2, transfected with RNAi Max transfection reagent only; lanes 3–12, Increasing CLCC1 and control siRNA amounts from 10 pmol (lanes 3,4) to 70 pmol (lanes 11, 12). CLCC1 proteins migrate at the predicted MW of 67 kDa. The blot shows a dose dependent reduction of CLCC1 protein expression in CLCC1 but not control siRNA treated ARPE19 cells to about 20% of normal. (b) TUNEL assay after siRNA transfection. Left: TUNEL-positive apoptotic cells (green), Second: CLCC1 (red), Third: DAPI (blue, nucleus). Although there is some variation in intensity of individual cells, probably based on cell size, shape, and orientation, staining for CLCC1 is lower overall in the CLCC1 siRNA treated cells than the control siRNA, control, or DNase 1 cells, consistent with the Western blot in Fig 5a. About 10% of CLCC1 siRNA transfected cells were apoptotic (arrows) but there is minimal apoptosis in control siRNA or untransfected cells. DNase I treated cells were 100% TUNEL-positive. Overlays of images from the first three columns are shown in the right column labeled Merged. Scale Bar: 20 μm. (c) Down regulation of CLCC1 induced apoptosis in nearly 10% of the cells (*** P<0.0001, t = 14.63) as compared to approximately 1% of cells treated with the control siRNA and less than 1% of untreated cells. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/30157172), licensed under a CC0-1.0 license. Not internally tested by Novus Biologicals.

Applications for CLCC1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CLCC1

Chloride channels (CLCs) regulate cellular traffic of chloride ions, a critical component of all living cells. CLCs are involved in membrane potential stabilization, signal transduction, cell volume regulation and organic solute transport. CLCC1 (Chloride channel CLIC-like protein 1), also known as MCLC (Mid-1-related chloride channel) or KIAA0761, is a 551 amino acid multi-pass membrane protein that belongs to the chloride channel MCLC family. CLCC1 is related to the Saccharomyces cerevisiaeprotein Mid-1 and is believed to function as an intracellular chloride channel that is expressed in lung, brain, muscle, liver and testis. Localizing to intracellular compartments such as the Golgi apparatus, the endoplasmic reticulum (ER) and the nuclear envelope, CLCC1 is expressed as four isoforms due to alternative splicing events, namely hMCLC-1, hMCLC-2, hMCLC-3 and hMCLC-4.

Alternate Names

chloride channel CLIC-like 1, KIAA0761, MCLCchloride channel CLIC-like protein 1, Mid1-related chloride channel, Mid-1-related chloride channel 1, Mid-1-related chloride channel protein 1

Gene Symbol

CLCC1

Additional CLCC1 Products

Product Documents for CLCC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CLCC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CLCC1 Antibody - BSA Free

Customer Reviews for CLCC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CLCC1 Antibody - BSA Free and earn rewards!

Have you used CLCC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...