CLIC4 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-85574
Loading...
Key Product Details
Validated by
Independent Antibodies
Species Reactivity
Validated:
Human
Predicted:
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: THPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGI
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for CLIC4 Antibody - BSA Free
Immunohistochemistry-Paraffin: CLIC4 Antibody - BSA Free [NBP1-85574]
Staining of human pancreas shows no positivity in exocrine glandular cells as expected.Immunohistochemistry-Paraffin: CLIC4 Antibody - BSA Free [NBP1-85574]
Staining of human liver shows no positivity in hepatocytes as expected.Immunohistochemistry-Paraffin: CLIC4 Antibody - BSA Free [NBP1-85574]
Staining of human kidney shows strong membranous and cytoplasmic positivity in cells in tubules.Immunohistochemistry-Paraffin: CLIC4 Antibody - BSA Free [NBP1-85574]
Staining of human skeletal muscle shows no positivity in myocytes as expected.Western Blot: CLIC4 Antibody - BSA Free [NBP1-85574]
Analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-CLIC4 antibody. Corresponding CLIC4 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.Immunohistochemistry-Paraffin: CLIC4 Antibody - BSA Free [NBP1-85574]
Immunohistochemistry analysis in human kidney and skeletal muscle tissues using HPA008019 antibody. Corresponding CLIC4 RNA-seq data are presented for the same tissues.Western Blot: CLIC4 Antibody - BSA Free [NBP1-85574] -
The N-terminal putative transmembrane domain (PTMD) is required for CLIC4 re-localization and Rac1 activation in response to S1P. (A) cartoon representation of the HA-tagged (∆PTMD)CLIC4 construct, and western blot analysis and quantification of its expression in HUVEC (see Methods), as compared to full-length HA-CLIC4. (B) Immunofluorescence of full-length HA-tagged CLIC4 (top) and (∆PTMD)CLIC4, and their localization after treatment with S1P. Yellow arrows denote PM localization. Scale bar represents 50 um in all panels. (C) the (∆PTMD)CLIC4 construct does not rescues the Rac1 activation defect caused by CLIC4KD, as assessed by G-LISA. (D) the (∆PTMD)CLIC4 construct does not rescue the TEER defect caused by CLIC4KD. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40235733), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for CLIC4 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CLIC4
Alternate Names
chloride intracellular channel 4, chloride intracellular channel 4 like, chloride intracellular channel protein 4, CLIC4L, DKFZp566G223, FLJ38640, H1, huH1, Intracellular chloride ion channel protein p64H1, MTCLIC, P64H1
Gene Symbol
CLIC4
Additional CLIC4 Products
Product Documents for CLIC4 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CLIC4 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for CLIC4 Antibody - BSA Free
Customer Reviews for CLIC4 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CLIC4 Antibody - BSA Free and earn rewards!
Have you used CLIC4 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...