CLNS1A Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35629

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-237 of human CLNS1A (NP_001284.1).

Sequence:
MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CLNS1A Antibody - BSA Free

CLNS1A Antibody

Western Blot: CLNS1A Antibody [NBP3-35629] -

Western Blot: CLNS1A Antibody [NBP3-35629] - Western blot analysis of various lysates using CLNS1A Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.
CLNS1A Antibody

Immunohistochemistry: CLNS1A Antibody [NBP3-35629] -

Immunohistochemistry: CLNS1A Antibody [NBP3-35629] - Immunohistochemistry analysis of paraffin-embedded Human esophageal using CLNS1A Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
CLNS1A Antibody

Immunohistochemistry: CLNS1A Antibody [NBP3-35629] -

Immunohistochemistry: CLNS1A Antibody [NBP3-35629] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using CLNS1A Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
CLNS1A Antibody

Immunohistochemistry: CLNS1A Antibody [NBP3-35629] -

Immunohistochemistry: CLNS1A Antibody [NBP3-35629] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using CLNS1A Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for CLNS1A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CLNS1A

The CLNS1A gene encodes a protein that functions in multiple regulatory pathways. The encoded protein complexes with numerouscytosolic proteins and performs diverse functions including regulation of small nuclear ribonucleoproteinbiosynthesis, platelet activati

Alternate Names

chloride channel regulatory protein, Chloride channel, nucleotide sensitive 1A, chloride channel, nucleotide-sensitive, 1A, Chloride conductance regulatory protein ICln, Chloride ion current inducer protein, CLCI, CLNS1B, I(Cln), ICLN, methylosome subunit pICln, Reticulocyte pICln, reticulocyte protein ICln

Gene Symbol

CLNS1A

Additional CLNS1A Products

Product Documents for CLNS1A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CLNS1A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CLNS1A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CLNS1A Antibody - BSA Free and earn rewards!

Have you used CLNS1A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...