Collagen I alpha 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82488

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This Collagen I alpha 1 antibody was developed against Recombinant Protein corresponding to amino acids: DRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

139 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Collagen I alpha 1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Collagen I alpha 1 Antibody [NBP1-82488]

Immunocytochemistry/ Immunofluorescence: Collagen I alpha 1 Antibody [NBP1-82488]

Immunocytochemistry/Immunofluorescence: Collagen I alpha 1 Antibody [NBP1-82488] - Staining of human cell line U-2 OS shows localization to cytosol & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP1-82488]

Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP1-82488]

Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP1-82488] - Staining of human colorectal cancer shows strong strong cytoplasmic positivity in tumor cells.
Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP1-82488]

Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP1-82488]

Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP1-82488] - Staining of human cervix shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP1-82488]

Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP1-82488]

Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP1-82488] - Staining of human colon shows moderate cytoplasmic positivity in stromal cells.

Applications for Collagen I alpha 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Collagen I alpha 1

Collagen is an extracellular matrix protein that serves as a scaffold defining the shape and mechanical properties of many tissues and organs including skin, tendon, artery walls, fibrocartilage, bone and teeth. Collagens are highly conserved and are characterized by an uninterrupted "Glycine X Y" triplet repeat that is a necessary part of the triple helical structure. The extensive family of collagens is composed of several chain types, including fibril-forming interstitial collagens (types I, II, III and V) and basement membrane collagens (type IV), each type containing multiple isoforms. Collagen type I (also known as collagen alpha, COL1A1, and alpha-1 type I collagen) is the largest component of fibrillar collagen found in cartilage and connective tissues. It is synthesized by fibroblasts, osteoblasts, and odontoblasts and has a theoretical molecular weight of 138 kDa.

Type I collagen is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon tissue. Collagens are fibrous, extracellular matrix proteins with high tensile strength and are the major components of connective tissue. Several collagens play a role in cell adhesion, responsible for maintaining normal tissue architecture and function. All collagens contain a triple helix domain and frequently show lateral self-association in order to form complex connective tissues. Post-Golgi LH3 trafficking is essential for collagen homeostasis and for the development and function of multiple organs and tissues (1).

The COL1A1 gene encodes the pro-alpha1 chains of type I collagen protein, whose triple helix is comprised of two alpha1 chains and one alpha2 chain. Mutations in the encoding COL1A1 gene are associated with brittle bone disease (Osteogenesis Imperfecta), cortical hyperostosis (Caffey disease) and disorders that affect the connective tissues (Ehlers-Danlos syndrome) (2). Studies have found that HIF-1 transcription regulation of collagen prolyl hydroxylases regulates collagen deposition, promoting cancer cell alignment along collagen fibers, which enhances invasion and metastasis to lymph nodes and lung tissue by breast cancer cells (3).

References

1. Banushi, B., Forneris, F., Straatman-Iwanowska, A., Strange, A., Lyne, A. M., Rogerson, C.,... Gissen, P. (2016). Regulation of post-Golgi LH3 trafficking is essential for collagen homeostasis. Nat Commun, 7, 12111. doi:10.1038/ncomms12111

2. Lu, Y., Zhang, S., Wang, Y., Ren, X., & Han, J. (2019). Molecular mechanisms and clinical manifestations of rare genetic disorders associated with type I collagen. Intractable Rare Dis Res, 8(2), 98-107. doi:10.5582/irdr.2019.01064

3. Gilkes, D. M., Chaturvedi, P., Bajpai, S., Wong, C. C., Wei, H., Pitcairn, S.,... Semenza, G. L. (2013). Collagen prolyl hydroxylases are essential for breast cancer metastasis. Cancer Res, 73(11), 3285-3296. doi:10.1158/0008-5472.Can-12-3963

Alternate Names

COL1A1, OI4

Entrez Gene IDs

1277 (Human)

Gene Symbol

COL1A1

UniProt

Additional Collagen I alpha 1 Products

Product Documents for Collagen I alpha 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Collagen I alpha 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Collagen I alpha 1 Antibody - BSA Free

Customer Reviews for Collagen I alpha 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Collagen I alpha 1 Antibody - BSA Free and earn rewards!

Have you used Collagen I alpha 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Collagen I alpha 1 Antibody - BSA Free

Showing  1 - 55 FAQs Showing All
  • Q: How long does delivery take for your collagen 1 alpha 1 antibody?

    A: Our most popular collagen I alpha 1 antibody (NB600-408) is usually in stock and ships priority overnight for next business day delivery in the U.S.

  • Q: I am looking for anti collagen 1 antibody, I see your product calls it collagen I alpha 1 is there a difference?

    A: Collagen I alpha 1 is the most common protein for the collagen 1 protein. There are other subunits as well (such as collagen 1 alpha 2…etc.).

  • Q: The predicted molecular weight says 150kDA but the band on the gel appears at 130kDA why is that?

    A: Differences between the predicted and observed MW can be affected by a number of factors including PTMs, relative charges and experimental factors. These cumulative effect of these differences can be quite substantial with larger molecules such as collagen I alpha 1.

  • Q: We are looking for an anti-Collagen antibody for Flow Cytometry (FACS) analysis in Swine sample. Would you please provide some references if there is any available as well?

    A:

    We currently have one antibody for porcine Collagen validated in flow cytometry (catalog # NBP1-94202).

  • Q: What secondary antibody do you recommend for collagen I alpha 1 antibodies?

    A: Because this collagen I alpha 1 antibody is raised in rabbit you would want to use any anti-rabbit IgG secondary antibody. NB7160 is a popular choice for use in WB.

  • Q: How long does delivery take for your collagen 1 alpha 1 antibody?

    A: Our most popular collagen I alpha 1 antibody (NB600-408) is usually in stock and ships priority overnight for next business day delivery in the U.S.

  • Q: I am looking for anti collagen 1 antibody, I see your product calls it collagen I alpha 1 is there a difference?

    A: Collagen I alpha 1 is the most common protein for the collagen 1 protein. There are other subunits as well (such as collagen 1 alpha 2…etc.).

  • Q: The predicted molecular weight says 150kDA but the band on the gel appears at 130kDA why is that?

    A: Differences between the predicted and observed MW can be affected by a number of factors including PTMs, relative charges and experimental factors. These cumulative effect of these differences can be quite substantial with larger molecules such as collagen I alpha 1.

  • Q: We are looking for an anti-Collagen antibody for Flow Cytometry (FACS) analysis in Swine sample. Would you please provide some references if there is any available as well?

    A:

    We currently have one antibody for porcine Collagen validated in flow cytometry (catalog # NBP1-94202).

  • Q: What secondary antibody do you recommend for collagen I alpha 1 antibodies?

    A: Because this collagen I alpha 1 antibody is raised in rabbit you would want to use any anti-rabbit IgG secondary antibody. NB7160 is a popular choice for use in WB.

  • Q: How long does delivery take for your collagen 1 alpha 1 antibody?

    A: Our most popular collagen I alpha 1 antibody (NB600-408) is usually in stock and ships priority overnight for next business day delivery in the U.S.

  • Q: I am looking for anti collagen 1 antibody, I see your product calls it collagen I alpha 1 is there a difference?

    A: Collagen I alpha 1 is the most common protein for the collagen 1 protein. There are other subunits as well (such as collagen 1 alpha 2…etc.).

  • Q: The predicted molecular weight says 150kDA but the band on the gel appears at 130kDA why is that?

    A: Differences between the predicted and observed MW can be affected by a number of factors including PTMs, relative charges and experimental factors. These cumulative effect of these differences can be quite substantial with larger molecules such as collagen I alpha 1.

  • Q: We are looking for an anti-Collagen antibody for Flow Cytometry (FACS) analysis in Swine sample. Would you please provide some references if there is any available as well?

    A:

    We currently have one antibody for porcine Collagen validated in flow cytometry (catalog # NBP1-94202).

  • Q: What secondary antibody do you recommend for collagen I alpha 1 antibodies?

    A: Because this collagen I alpha 1 antibody is raised in rabbit you would want to use any anti-rabbit IgG secondary antibody. NB7160 is a popular choice for use in WB.

  • Q: How long does delivery take for your collagen 1 alpha 1 antibody?

    A: Our most popular collagen I alpha 1 antibody (NB600-408) is usually in stock and ships priority overnight for next business day delivery in the U.S.

  • Q: I am looking for anti collagen 1 antibody, I see your product calls it collagen I alpha 1 is there a difference?

    A: Collagen I alpha 1 is the most common protein for the collagen 1 protein. There are other subunits as well (such as collagen 1 alpha 2…etc.).

  • Q: The predicted molecular weight says 150kDA but the band on the gel appears at 130kDA why is that?

    A: Differences between the predicted and observed MW can be affected by a number of factors including PTMs, relative charges and experimental factors. These cumulative effect of these differences can be quite substantial with larger molecules such as collagen I alpha 1.

  • Q: We are looking for an anti-Collagen antibody for Flow Cytometry (FACS) analysis in Swine sample. Would you please provide some references if there is any available as well?

    A:

    We currently have one antibody for porcine Collagen validated in flow cytometry (catalog # NBP1-94202).

  • Q: What secondary antibody do you recommend for collagen I alpha 1 antibodies?

    A: Because this collagen I alpha 1 antibody is raised in rabbit you would want to use any anti-rabbit IgG secondary antibody. NB7160 is a popular choice for use in WB.

  • Q: How long does delivery take for your collagen 1 alpha 1 antibody?

    A: Our most popular collagen I alpha 1 antibody (NB600-408) is usually in stock and ships priority overnight for next business day delivery in the U.S.

  • Q: I am looking for anti collagen 1 antibody, I see your product calls it collagen I alpha 1 is there a difference?

    A: Collagen I alpha 1 is the most common protein for the collagen 1 protein. There are other subunits as well (such as collagen 1 alpha 2…etc.).

  • Q: The predicted molecular weight says 150kDA but the band on the gel appears at 130kDA why is that?

    A: Differences between the predicted and observed MW can be affected by a number of factors including PTMs, relative charges and experimental factors. These cumulative effect of these differences can be quite substantial with larger molecules such as collagen I alpha 1.

  • Q: We are looking for an anti-Collagen antibody for Flow Cytometry (FACS) analysis in Swine sample. Would you please provide some references if there is any available as well?

    A:

    We currently have one antibody for porcine Collagen validated in flow cytometry (catalog # NBP1-94202).

  • Q: What secondary antibody do you recommend for collagen I alpha 1 antibodies?

    A: Because this collagen I alpha 1 antibody is raised in rabbit you would want to use any anti-rabbit IgG secondary antibody. NB7160 is a popular choice for use in WB.

Showing  1 - 55 FAQs Showing All
View all FAQs for Antibodies
Loading...