CPI17 alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-37897

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: VKYDRRELQRRLDVEKWIDGRLEELYRGMEADMPDEINIDELLELESEEERSR

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CPI17 alpha Antibody - BSA Free

Western Blot: CPI17 alpha Antibody [NBP2-37897]

Western Blot: CPI17 alpha Antibody [NBP2-37897]

Western Blot: CPI17 alpha Antibody [NBP2-37897] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line A-549
Immunohistochemistry-Paraffin: CPI17 alpha Antibody [NBP2-37897]

Immunohistochemistry-Paraffin: CPI17 alpha Antibody [NBP2-37897]

Immunohistochemistry-Paraffin: CPI17 alpha Antibody [NBP2-37897] - Staining in human cerebral cortex and skin tissues using anti-PPP1R14A antibody. Corresponding PPP1R14A RNA-seq data are presented for the same tissues.
Immunohistochemistry: CPI17 alpha Antibody [NBP2-37897]

Immunohistochemistry: CPI17 alpha Antibody [NBP2-37897]

Immunohistochemistry: CPI17 alpha Antibody [NBP2-37897] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferus ducts.
Immunohistochemistry-Paraffin: CPI17 alpha Antibody [NBP2-37897]

Immunohistochemistry-Paraffin: CPI17 alpha Antibody [NBP2-37897]

Immunohistochemistry-Paraffin: CPI17 alpha Antibody [NBP2-37897] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: CPI17 alpha Antibody [NBP2-37897]

Immunohistochemistry-Paraffin: CPI17 alpha Antibody [NBP2-37897]

Immunohistochemistry-Paraffin: CPI17 alpha Antibody [NBP2-37897] - Staining of human skin shows low expression as expected.

Applications for CPI17 alpha Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. See Simple Western Antibody Database for Simple Western validation: Separated by size; matrix was 12-230 kDa; detected by Chemiluminescence.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CPI17 alpha

PKC Potentiated Inhibitor Protein-17 (CPI-17) is a 17 kDa protein (1). Expressed in smooth muscles and neuronal cells, CPI-17 is a myosin phosphatase inhibitor protein. Phosphorylation of CPI-17 at Thr38 enhances its inhibitory effect by 100 fold (2). Once phosphorylated, CPI-17 inhibits PP1c and MLCP holoenzyme activity (3).

Alternate Names

17 kDa PKC-potentiated inhibitory protein of PP1, CPI-1717-kDa PKC-potentiated inhibitory protein of PP1, CPI1717-KDa protein, PKC-potentiated inhibitory protein of PP1, PPP1INL, Protein kinase C-potentiated inhibitor protein of 17 kDa, protein phosphatase 1 regulatory subunit 14A, protein phosphatase 1, regulatory (inhibitor) subunit 14A

Gene Symbol

PPP1R14A

UniProt

Additional CPI17 alpha Products

Product Documents for CPI17 alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CPI17 alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CPI17 alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CPI17 alpha Antibody - BSA Free and earn rewards!

Have you used CPI17 alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...