CSTF3 Antibody (1D4) - Azide and BSA Free
Novus Biologicals | Catalog # H00001479-M01
Loading...
Key Product Details
Species Reactivity
Human, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG1 kappa Clone # 1D4
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
CSTF3 (AAH09792, 1 a.a. ~ 103 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN
Localization
Nuclear
Specificity
CSTF3 - cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa
Clonality
Monoclonal
Host
Mouse
Isotype
IgG1 kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for CSTF3 Antibody (1D4) - Azide and BSA Free
Western Blot: CSTF3 Antibody (1D4) [H00001479-M01]
Western Blot: CSTF3 Antibody (1D4) [H00001479-M01] - Analysis of CSTF3 expression in transfected 293T cell line by CSTF3 monoclonal antibody (M01), clone 1D4. Lane 1: CSTF3 transfected lysate(11.44 KDa). Lane 2: Non-transfected lysate.Immunocytochemistry/ Immunofluorescence: CSTF3 Antibody (1D4) [H00001479-M01]
Immunocytochemistry/Immunofluorescence: CSTF3 Antibody (1D4) [H00001479-M01] - Analysis of monoclonal antibody to CSTF3 on HeLa cell. Antibody concentration 10 ug/ml.Immunohistochemistry-Paraffin: CSTF3 Antibody (1D4) [H00001479-M01]
Immunohistochemistry-Paraffin: CSTF3 Antibody (1D4) [H00001479-M01] - Analysis of monoclonal antibody to CSTF3 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.Western Blot: CSTF3 Antibody (1D4) [H00001479-M01]
Western Blot: CSTF3 Antibody (1D4) [H00001479-M01] - Analysis of CSTF3 over-expressed 293 cell line, cotransfected with CSTF3 Validated Chimera RNAi ( Cat # H00001479-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CSTF3 monoclonal antibody (M01), clone 1D4 (Cat # H00001479-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Sandwich ELISA: CSTF3 Antibody (1D4) [H00001479-M01] - Detection limit for recombinant GST tagged CSTF3 is approximately 0.1ng/ml as a capture antibody.
Applications for CSTF3 Antibody (1D4) - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactivity against recombinant protein and transfected lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA.
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: CSTF3
Alternate Names
CF-1 77 kDa subunit, Cleavage stimulation factor 77 kDa subunit, cleavage stimulation factor subunit 3, cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kD, cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa, CSTF 77 kDa subunit, CstF-77, MGC117398, MGC43001, MGC75122
Entrez Gene IDs
1479 (Human)
Gene Symbol
CSTF3
OMIM
600367 (Human)
UniProt
Additional CSTF3 Products
Product Documents for CSTF3 Antibody (1D4) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CSTF3 Antibody (1D4) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for CSTF3 Antibody (1D4) - Azide and BSA Free
Customer Reviews for CSTF3 Antibody (1D4) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review CSTF3 Antibody (1D4) - Azide and BSA Free and earn rewards!
Have you used CSTF3 Antibody (1D4) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...