Ctip1 Antibody (3D9) - Azide and BSA Free
Novus Biologicals | Catalog # H00053335-M03
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2a Kappa Clone # 3D9
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
BCL11A (NP_060484, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS
Specificity
BCL11A - B-cell CLL/lymphoma 11A (zinc finger protein) (3D9)
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2a Kappa
Scientific Data Images for Ctip1 Antibody (3D9) - Azide and BSA Free
Western Blot: Ctip1 Antibody (3D9) [H00053335-M03]
Western Blot: Ctip1 Antibody (3D9) [H00053335-M03] - Analysis of BCL11A expression in transfected 293T cell line by BCL11A monoclonal antibody (M03), clone 3D9. Lane 1: BCL11A transfected lysatE (26.865 KDa). Lane 2: Non-transfected lysate.Immunocytochemistry/ Immunofluorescence: Ctip1 Antibody (3D9) [H00053335-M03]
Immunocytochemistry/Immunofluorescence: Ctip1 Antibody (3D9) [H00053335-M03] - Analysis of monoclonal antibody to BCL11A on HeLa cell. Antibody concentration 10 ug/mlImmunohistochemistry-Paraffin: Ctip1 Antibody (3D9) [H00053335-M03]
Immunohistochemistry-Paraffin: Ctip1 Antibody (3D9) [H00053335-M03] - Analysis of monoclonal antibody to BCL11A on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/mlELISA: Ctip1 Antibody (3D9) [H00053335-M03]
ELISA: Ctip1 Antibody (3D9) [H00053335-M03] - Detection limit for recombinant GST tagged BCL11A is 0.03 ng/ml as a capture antibody.Applications for Ctip1 Antibody (3D9) - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: Ctip1
Alternate Names
B-cell CLL/lymphoma 11A, B-cell CLL/lymphoma 11A (zinc finger protein), B-cell CLL/lymphoma 11A (zinc finger protein) isoform 2, B-cell lymphoma/leukemia 11A, BCL-11A, BCL11A B-cell CLL/lymphoma 11A (zinc finger protein) isoform 1, BCL11A-S, BCL11A-XL, C2H2-type zinc finger protein, COUP-TF-interacting protein 1, CTIP1ecotropic viral integration site 9, ecotropic viral integration site 9 homolog, Ecotropic viral integration site 9 protein homolog, EVI-9, EVI9FLJ34997, HBFQTL5, KIAA1809BCL11A-L, Zinc finger protein 856, ZNF856FLJ10173
Entrez Gene IDs
53335 (Human)
Gene Symbol
BCL11A
UniProt
Additional Ctip1 Products
Product Documents for Ctip1 Antibody (3D9) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Ctip1 Antibody (3D9) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Ctip1 Antibody (3D9) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review Ctip1 Antibody (3D9) - Azide and BSA Free and earn rewards!
Have you used Ctip1 Antibody (3D9) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...