CXCR5 Antibody

Name: CXCR5 Antibody
Brand: Novus Biologicals
SKU: NBP2-48763
Price: 299 USD
Availability: InStock

Novus Biologicals | Catalog # NBP2-48763

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

View all CXCR5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CXCR5 Antibody

Immunohistochemistry-Paraffin: CXCR5 Antibody [NBP2-48763]

Immunohistochemistry-Paraffin: CXCR5 Antibody [NBP2-48763] - Analysis in human tonsil and cerebral cortex tissues. Corresponding CXCR5 RNA-seq data are presented for the same tissues

Immunohistochemistry-Paraffin: CXCR5 Antibody [NBP2-48763]

Immunohistochemistry-Paraffin: CXCR5 Antibody [NBP2-48763] - Staining of human cerebral cortex shows no positivity as expected.

Immunohistochemistry-Paraffin: CXCR5 Antibody [NBP2-48763]

Immunohistochemistry-Paraffin: CXCR5 Antibody [NBP2-48763] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: CXCR5 Antibody [NBP2-48763]

Immunohistochemistry-Paraffin: CXCR5 Antibody [NBP2-48763] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in lymphoid cells.

View 1 more images

Applications for CXCR5 Antibody

Application

Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Application Notes

For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CXCR5

Chemokines play important roles in inflammation and critical for the recruitment of effector immune cells to sites of infection. Chemokines activate leukocytes by binding to G protein coupled receptors (1). The ever-growing chemokine receptor subtypes can be divided into 2 major groups, CXCR and CCR, based on the 2 major classes of chemokines. One of the CCR receptors, CCR1, is expressed on neutrophils, monocytes, lymphocytes, and eosinophils and binds the leukocyte chemoattractant and hemopoiesis regulator macrophage-inflammatory protein (MIP-1 ), eotaxin, as well as several other related chemokines (2-4). Mice lacking the chemokine receptor CCR1 have defects in neutrophil trafficking and proliferation (5,6).

Alternate Names

BLR1, CD185, CXCR5

Gene Symbol

CXCR5

Additional CXCR5 Products

Product Documents for CXCR5 Antibody

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CXCR5 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.