CXCR7/RDC-1 is a G protein-coupled receptor (GPCR) member of the CXC subfamily of chemokine receptors. Human CXCR7/RDC-1 is 362 amino acids (aa) in length with a predicted molecular weight of 41 kDa. Mouse and rat CXCR7/RDC-1 share 93% aa sequence identity with the human protein. CXCR7/RDC-1 binds to and acts as a scavenger for CXCL11/I-TAC and CXCL12/SDF-1. CXCR7/RDC-1 can also function as a co-receptor for HIV and SIV. Unlike other chemokine receptors, CXCR7/RDC-1 does not activate G protein signaling, but instead initiates beta-Arrestin-mediated receptor-ligand internalization. Although CXCR7/RDC-1 itself does not activate G protein signaling, the receptor can heterodimerize with CXCR4 to activate G proteins in response to CXCL12/SDF-1 binding. Studies on CXCR7/RDC-1 knockout mice suggest that it is critical for cardiovascular development. While CXCR7/RDC-1 does not appear to signal in normal hematopoietic cells, it is highly expressed in leukemic cells where it activates Akt signaling that promotes cell trafficking and adhesion. CXCR7/RDC-1 also mediates neuronal migration, displays aberrant signaling in astrocytes, and is highly expressed in glioma cells.
CXCR7/RDC-1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-13885
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (84%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit CXCR7/RDC-1 Antibody - BSA Free (NBP2-13885) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for CXCR7/RDC-1 Antibody - BSA Free
Immunohistochemistry-Paraffin: CXCR7/RDC-1 Antibody [NBP2-13885]
Immunohistochemistry-Paraffin: CXCR7/RDC-1 Antibody [NBP2-13885] - Staining of human placenta shows cytoplasmic positivity in trophoblasts.Applications for CXCR7/RDC-1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CXCR7/RDC-1
Alternate Names
ACKR3, CMKOR1, CXCR7, GPR159, RDC-1
Gene Symbol
ACKR3
Additional CXCR7/RDC-1 Products
Product Documents for CXCR7/RDC-1 Antibody - BSA Free
Product Specific Notices for CXCR7/RDC-1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for CXCR7/RDC-1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CXCR7/RDC-1 Antibody - BSA Free and earn rewards!
Have you used CXCR7/RDC-1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...