During the G1 phase of the cell cycle, a cell must choose between rest and cell division. A small subfamily of cyclin family molecules, termed cyclin D proteins (D1, D2, D3), promotes commitment to mitosis. They accomplish this by interacting with cyclin-dependent kinases (cdk4 and cdk6) to generate Ser/Thr kinase complexes that remove blocks on DNA synthesis.
Cyclin D2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-14460
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Rat
Cited:
Human, Rat
Applications
Validated:
Immunohistochemistry, Immunocytochemistry/ Immunofluorescence
Cited:
Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRGIDL
Reactivity Notes
Use in Rat reported in scientific literature (PMID:33326842) Reactivity reported in scientific literature (PMID: 23227862).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Cyclin D2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: Cyclin D2 Antibody [NBP2-14460]
Immunocytochemistry/Immunofluorescence: Cyclin D2 Antibody [NBP2-14460] - Staining of 8226, U266, LP-1, KMS12 and Daudi cells. Image submitted by a verified customer review.Immunohistochemistry: Cyclin D2 Antibody [NBP2-14460]
Cyclin-D2-Antibody-Immunohistochemistry-NBP2-14460-img0007.jpgImmunocytochemistry/ Immunofluorescence: Cyclin D2 Antibody [NBP2-14460]
Immunocytochemistry/Immunofluorescence: Cyclin D2 Antibody [NBP2-14460] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm. Antibody staining is shown in green.Applications for Cyclin D2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0161859)
Reviewed Applications
Read 1 review rated 5 using NBP2-14460 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Cyclin D2
Alternate Names
CCND2, Vin1
Gene Symbol
CCND2
Additional Cyclin D2 Products
Product Documents for Cyclin D2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Cyclin D2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Cyclin D2 Antibody - BSA Free
Customer Reviews for Cyclin D2 Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used Cyclin D2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: ImmunofluorescenceSample Tested: 8226 (multiple myeloma), U266 (multiple myeloma), LP-1 (multiple myeloma), KMS12 (multiple myeloma), Daudi (Burkitt lymphoma)Species: HumanVerified Customer | Posted 11/17/2015IFF/ICC staining of 8226, U266, LP-1, KMS12 and Daudi with NBP2-14460
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...