Cystatin A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86989

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Cystatin A Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: IPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Cystatin A Antibody - BSA Free (NBP1-86989) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Cystatin A Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Cystatin A Antibody - BSA Free

Cystatin A Antibody - BSA Free Immunohistochemistry-Paraffin: Cystatin A Antibody - BSA Free [NBP1-86989]

Immunohistochemistry-Paraffin: Cystatin A Antibody - BSA Free [NBP1-86989]

Staining of human cell line hTCEpi shows localization to nucleus & cytosol.
Cystatin A Antibody - BSA Free Western Blot: Cystatin A Antibody - BSA Free [NBP1-86989]

Western Blot: Cystatin A Antibody - BSA Free [NBP1-86989]

Analysis in human esophagus tissue.
Cystatin A Antibody - BSA Free Western Blot: Cystatin A Antibody - BSA Free [NBP1-86989]

Western Blot: Cystatin A Antibody - BSA Free [NBP1-86989]

Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CSTA antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Cystatin A Antibody - BSA Free Immunohistochemistry-Paraffin: Cystatin A Antibody - BSA Free [NBP1-86989]

Immunohistochemistry-Paraffin: Cystatin A Antibody - BSA Free [NBP1-86989]

Staining of human cerebral cortex shows very weak positivity in neuronal cells.
Cystatin A Antibody - BSA Free Immunohistochemistry-Paraffin: Cystatin A Antibody - BSA Free [NBP1-86989]

Immunohistochemistry-Paraffin: Cystatin A Antibody - BSA Free [NBP1-86989]

Staining of human skin shows strong cytoplasmic and membranous positivity in squamous epithelial cells.
Cystatin A Antibody - BSA Free Immunohistochemistry-Paraffin: Cystatin A Antibody - BSA Free [NBP1-86989]

Immunohistochemistry-Paraffin: Cystatin A Antibody - BSA Free [NBP1-86989]

Staining of human pancreas shows very weak positivity in exocrine glandular cells.
Cystatin A Antibody - BSA Free Immunohistochemistry-Paraffin: Cystatin A Antibody - BSA Free [NBP1-86989]

Immunohistochemistry-Paraffin: Cystatin A Antibody - BSA Free [NBP1-86989]

Staining of human tonsil shows strong cytoplasmic and membranous positivity in germinal and non germinal center cells.
Cystatin A Antibody - BSA Free Immunohistochemistry-Paraffin: Cystatin A Antibody - BSA Free [NBP1-86989]

Immunohistochemistry-Paraffin: Cystatin A Antibody - BSA Free [NBP1-86989]

Staining of human esophagus shows strong cytoplasmic and membranous positivity in squamous epithelial cells.

Applications for Cystatin A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cystatin A

Cystatin A, also known as Stefin A, Cystatin AS or Keratolinin, is a member of family 1 of the cystatin superfamily. It is a 98 amino acid, intracellular inhibitor regulating the activities of cysteine proteases of the papain family such as Cathepsins B, H and L.

Alternate Names

AREI, CSTA, Stefin A, STF1, STFA

Gene Symbol

CSTA

Additional Cystatin A Products

Product Documents for Cystatin A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cystatin A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cysteine Proteases and Regulators

Citations for Cystatin A Antibody - BSA Free

Customer Reviews for Cystatin A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cystatin A Antibody - BSA Free and earn rewards!

Have you used Cystatin A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies