Cytochrome P450 2E1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85367

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot, Westen Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cytochrome P450 2E1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367]

Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367]

Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Analysis in human liver and endometrium tissues. Corresponding CYP2E1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367]

Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367]

Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human endometrium, liver, liver cancer and tonsil using Anti-CYP2E1 antibody NBP1-85367 (A) shows similar protein distribution across tissues to independent antibody NBP1-85366 (B).
Western Blot: Cytochrome P450 2E1 Antibody [NBP1-85367]

Western Blot: Cytochrome P450 2E1 Antibody [NBP1-85367]

Western Blot: Cytochrome P450 2E1 Antibody [NBP1-85367] - Western blot analysis in mouse liver tissue and rat liver tissue.
Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367]

Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367]

Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human endometrium shows no positivity in glandular or stromal cells as expected.
Western Blot: Cytochrome P450 2E1 Antibody [NBP1-85367]

Western Blot: Cytochrome P450 2E1 Antibody [NBP1-85367]

Western Blot: Cytochrome P450 2E1 Antibody [NBP1-85367] - Analysis in human liver tissue.
Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367]

Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367]

Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human liver cancer shows moderate cytoplasmic positivity in tumor cells.
Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367]

Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367]

Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367]

Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367]

Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human tonsil shows no positivity in germinal center cells as expected.
Cytochrome P450 2E1 Antibody

Western Blot: Rabbit Polyclonal Cytochrome P450 2E1 Antibody [NBP1-85367]

Western Blot: Rabbit Polyclonal Cytochrome P450 2E1 Antibody [NBP1-85367] - Western Blot of the liver homogenates from control and alcohol-fed mice. Image from a verified customer review.
Cytochrome P450 2E1 Antibody

Western Blot: Rabbit Polyclonal Cytochrome P450 2E1 Antibody [NBP1-85367]

Western Blot: Rabbit Polyclonal Cytochrome P450 2E1 Antibody [NBP1-85367] - Cytochrome P450 2E1 western blot of the homogenates from control and alcohol-fed rats. Image from a verified customer review.
Cytochrome P450 2E1 Antibody

Western Blot: Rabbit Polyclonal Cytochrome P450 2E1 Antibody [NBP1-85367]

Western Blot: Rabbit Polyclonal Cytochrome P450 2E1 Antibody [NBP1-85367] - Cytochrome P450 2E1 western blot of the lysate of VL-17A cells (Hep G2 cells that stably express both Cytochrome P450 2E1 and ADH): control and treated with EtOH. Image from a verified customer review.

Applications for Cytochrome P450 2E1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 5 reviews rated 5 using NBP1-85367 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cytochrome P450 2E1

Alternate Names

4-nitrophenol 2-hydroxylase, CPE1, CYP2Ecytochrome P450 2E1, CYPIIE1, cytochrome P450, family 2, subfamily E, polypeptide 1, cytochrome P450, subfamily IIE (ethanol-inducible), polypeptide 1, Cytochrome P450-J, EC 1.14.13.-, EC 1.14.13.n7, EC 1.14.14.1, flavoprotein-linked monooxygenase, microsomal monooxygenase, P450C2E, P450-J, xenobiotic monooxygenase

Gene Symbol

CYP2E1

Additional Cytochrome P450 2E1 Products

Product Documents for Cytochrome P450 2E1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cytochrome P450 2E1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Cytochrome P450 2E1 Antibody - BSA Free

Customer Reviews for Cytochrome P450 2E1 Antibody - BSA Free (5)

5 out of 5
5 Customer Ratings
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Cytochrome P450 2E1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 55 reviews Showing All
Filter By:
  • Cytochrome P450 2E1 Antibody
    Name: Armen Petrosyan
    Application: Western Blot
    Sample Tested: HepG2 CELLS
    Species: Human
    Verified Customer | Posted 11/10/2024
    CYP2E1 W-B of the lysate of VL-17A cells (Hep G2 cells that stably express both CYP2E1 and ADH): control and treated with EtOH.
    Cytochrome P450 2E1 Antibody - BSA Free NBP1-85367
  • Cytochrome P450 2E1 Antibody
    Name: Armen Petrosyan
    Application: Western Blot
    Sample Tested: Rat hepatocytes
    Species: Rat
    Verified Customer | Posted 11/09/2024
    CYP2E1 W-B of the homogenates from control and alcohol-fed rats
    Cytochrome P450 2E1 Antibody - BSA Free NBP1-85367
  • Cytochrome P450 2E1 Antibody
    Name: Armen Petrosyan
    Application: Immunocytochemistry/Immunofluorescence
    Sample Tested: HepG2 hepatoma cells
    Species: Human
    Verified Customer | Posted 11/06/2024
    VA-13 cells (mouse ADH1-transfected HepG2 cells) stained with Cytochrome P450 2E1 Antibody
    Cytochrome P450 2E1 Antibody - BSA Free NBP1-85367
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
  • Cytochrome P450 2E1 Antibody
    Name: Armen Petrosyan
    Application: Western Blot
    Sample Tested: Liver homogenates sample
    Species: Mouse
    Verified Customer | Posted 11/06/2024
    W-B of the liver homogenates from control and alcohol-fed mice
    Cytochrome P450 2E1 Antibody - BSA Free NBP1-85367
  • Cytochrome P450 2E1 Antibody
    Name: Marta Melis
    Application: Immunohistochemistry-Paraffin
    Sample Tested: mouse liver FFPE section and mouse liver paraffin section
    Species: Mouse
    Verified Customer | Posted 12/21/2019
    Antigen retrieval performed in citrate buffer for 3 minutes; NBP1-85367 antibody dilution was1:100, incubation was 2h at room temperature; DAB developing time was 5 minutes
    Cytochrome P450 2E1 Antibody - BSA Free NBP1-85367

There are no reviews that match your criteria.

Showing  1 - 55 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...