Cytochrome P450 4A Antibody (10D10W7)

Novus Biologicals | Catalog # NBP3-15847

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10D10W7 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Cytochrome P450 4A (CYP4A11) (Q02928). QFPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAF

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Cytochrome P450 4A Antibody (10D10W7)

Western Blot: Cytochrome P450 4A Antibody (10D10W7) [NBP3-15847]

Western Blot: Cytochrome P450 4A Antibody (10D10W7) [NBP3-15847]

Western Blot: Cytochrome P450 4A Antibody (10D10W7) [NBP3-15847] - Western blot analysis of extracts of various cell lines, using Cytochrome P450 4A (CYP4A11) Rabbit mAb (NBP3-15847) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Cytochrome P450 4A Antibody (10D10W7)

Immunohistochemistry: Cytochrome P450 4A Antibody (10D10W7) [NBP3-15847] -

Immunohistochemistry: Cytochrome P450 4A Antibody (10D10W7) [NBP3-15847] - Immunohistochemistry analysis of Cytochrome P450 4A in paraffin-embedded mouse kidney tissue using Cytochrome P450 4A Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Cytochrome P450 4A Antibody (10D10W7)

Immunohistochemistry: Cytochrome P450 4A Antibody (10D10W7) [NBP3-15847] -

Immunohistochemistry: Cytochrome P450 4A Antibody (10D10W7) [NBP3-15847] - Immunohistochemistry analysis of Cytochrome P450 4A in paraffin-embedded rat kidney tissue using Cytochrome P450 4A Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Cytochrome P450 4A Antibody (10D10W7)

Immunohistochemistry: Cytochrome P450 4A Antibody (10D10W7) [NBP3-15847] -

Immunohistochemistry: Cytochrome P450 4A Antibody (10D10W7) [NBP3-15847] - Immunohistochemistry analysis of Cytochrome P450 4A in paraffin-embedded human liver tissue using Cytochrome P450 4A Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for Cytochrome P450 4A Antibody (10D10W7)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cytochrome P450 4A

Alternate Names

20-HETE synthase, CP4Y, CYP4A2, cytochrome P450 4A11, cytochrome P450, family 4, subfamily A, polypeptide 11, cytochrome P450, subfamily IVA, polypeptide 11, cytochrome P-450HK-omega, cytochrome P450HL-omega, fatty acid omega-hydroxylase, lauric acid omega-hydroxylase, P450HL-omega

Gene Symbol

CYP4A11

Additional Cytochrome P450 4A Products

Product Documents for Cytochrome P450 4A Antibody (10D10W7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cytochrome P450 4A Antibody (10D10W7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cytochrome P450 4A Antibody (10D10W7)

There are currently no reviews for this product. Be the first to review Cytochrome P450 4A Antibody (10D10W7) and earn rewards!

Have you used Cytochrome P450 4A Antibody (10D10W7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...