Cytokeratin 15 Antibody (9F9F0)

Novus Biologicals | Catalog # NBP3-16492

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9F9F0 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 357-456 of human Cytokeratin 15 (P19012). YATQLQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMAGIAIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Cytokeratin 15 Antibody (9F9F0)

Western Blot: Cytokeratin 15 Antibody (9F9F0) [NBP3-16492]

Western Blot: Cytokeratin 15 Antibody (9F9F0) [NBP3-16492]

Western Blot: Cytokeratin 15 Antibody (9F9F0) [NBP3-16492] - Western blot analysis of extracts of Cal-27 cells, using Cytokeratin 15 (KRT15) antibody (NBP3-16492) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Immunohistochemistry: Cytokeratin 15 Antibody (9F9F0) [NBP3-16492]

Immunohistochemistry: Cytokeratin 15 Antibody (9F9F0) [NBP3-16492]

Immunohistochemistry: Cytokeratin 15 Antibody (9F9F0) [NBP3-16492] - Immunofluorescence analysis of rat skin using Cytokeratin 15 (KRT15) Rabbit mAb (NBP3-16492) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for Cytokeratin 15 Antibody (9F9F0)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cytokeratin 15

Long Name

keratin 15

Alternate Names

CK15, CK-15, cytokeratin 15, cytokeratin-15, K15, K15keratin-15, basic, K1CO, keratin 15, keratin, type I cytoskeletal 15, Keratin-15, keratin-15, beta, KRTB, type I cytoskeletal 15

Gene Symbol

KRT15

Additional Cytokeratin 15 Products

Product Documents for Cytokeratin 15 Antibody (9F9F0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cytokeratin 15 Antibody (9F9F0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cytokeratin 15 Antibody (9F9F0)

There are currently no reviews for this product. Be the first to review Cytokeratin 15 Antibody (9F9F0) and earn rewards!

Have you used Cytokeratin 15 Antibody (9F9F0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...