DAP5 Antibody (3B5) - Azide and BSA Free

Novus Biologicals | Catalog # H00001982-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 3B5

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

EIF4G2 (NP_001409, 811 a.a. ~ 889 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQ

Specificity

EIF4G2 - eukaryotic translation initiation factor 4 gamma, 2

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for DAP5 Antibody (3B5) - Azide and BSA Free

Western Blot: DAP5 Antibody (3B5) [H00001982-M01]

Western Blot: DAP5 Antibody (3B5) [H00001982-M01]

Western Blot: DAP5 Antibody (3B5) [H00001982-M01] - EIF4G2 monoclonal antibody (M01), clone 3B5 Analysis of EIF4G2 expression in Hela S3 NE.
Immunohistochemistry-Paraffin: DAP5 Antibody (3B5) [H00001982-M01]

Immunohistochemistry-Paraffin: DAP5 Antibody (3B5) [H00001982-M01]

Immunohistochemistry-Paraffin: DAP5 Antibody (3B5) [H00001982-M01] - Analysis of monoclonal antibody to EIF4G2 on formalin-fixed paraffin-embedded human heart. Antibody concentration 3 ug/ml.
Western Blot: DAP5 Antibody (3B5) [H00001982-M01]

Western Blot: DAP5 Antibody (3B5) [H00001982-M01]

Western Blot: DAP5 Antibody (3B5) [H00001982-M01] - EIF4G2 monoclonal antibody (M01), clone 3B5. Analysis of EIF4G2 expression in PC-12.

Applications for DAP5 Antibody (3B5) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: DAP5

Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

Alternate Names

aging-associated protein 1, DAP-5, DAP5AAG1, Death-associated protein 5, eIF4G 2, eIF-4G 2, eIF-4-gamma 2, eukaryotic translation initiation factor 4 gamma 2, eukaryotic translation initiation factor 4 gamma, 2, eukaryotic translation initiation factor 4G-like 1, FLJ41344, NAT1, P97

Entrez Gene IDs

1982 (Human)

Gene Symbol

EIF4G2

OMIM

602325 (Human)

Additional DAP5 Products

Product Documents for DAP5 Antibody (3B5) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DAP5 Antibody (3B5) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for DAP5 Antibody (3B5) - Azide and BSA Free

Customer Reviews for DAP5 Antibody (3B5) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review DAP5 Antibody (3B5) - Azide and BSA Free and earn rewards!

Have you used DAP5 Antibody (3B5) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...