DNASE1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84999

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YVRPSQWSSIRLWTSPTFQWLIPDSADTTATPTHCAYDRIVVAGMLLRGAVVPDSALPFNFQAAYGLSDQLAQAISDHY

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DNASE1 Antibody - BSA Free

Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999]

Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999]

Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] - Analysis in human duodenum and liver tissues using Anti-DNASE1 antibody. Corresponding DNASE1 RNA-seq data are presented for the same tissues.
Western Blot: DNASE1 Antibody [NBP1-84999]

Western Blot: DNASE1 Antibody [NBP1-84999]

Western Blot: DNASE1 Antibody [NBP1-84999] - Analysis in control (vector only transfected HEK293T lysate) and DNASE1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999]

Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999]

Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999]

Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999]

Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] - Staining of human liver shows low expression as expected.
DNASE1 Antibody

Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] -

Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] -Staining of human placenta shows no positivity in trophoblastic cells as expected.
DNASE1 Antibody

Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] -

Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] -Staining of human skeletal muscle shows no positivity in myocytes as expected.
DNASE1 Antibody

Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] -

Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] -Staining of human liver shows no positivity in hepatocytes as expected.

Applications for DNASE1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNASE1

DNASE1, also known as Deoxyribonuclease 1, is an endonuclease found in the zymogen granules of the nuclear envelope. Responsible for DNA fragmentation and cell death during apoptosis, DNASE1 binds to G-actin and blocks actin polymerization. Mutations in DNASE1 cause systemic lupus erythematosus (SLE), an autoimmune disease causing inflammation and tissue damage. DNASE1 is also known to treat symptoms of cystic fibrosis.

Alternate Names

deoxyribonuclease IFLJ38093, deoxyribonuclease-1, DKFZp686H0155, DNase I, DNase I, lysosomal, DNL1FLJ44902, Dornase alfa, DRNI, EC 3.1.21.1, human urine deoxyribonuclease I

Gene Symbol

DNASE1

Additional DNASE1 Products

Product Documents for DNASE1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DNASE1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for DNASE1 Antibody - BSA Free

Customer Reviews for DNASE1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNASE1 Antibody - BSA Free and earn rewards!

Have you used DNASE1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...