EIF2B2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38367

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human EIF2B2 (NP_055054.1).

Sequence:
MPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMELIRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for EIF2B2 Antibody - BSA Free

EIF2B2 Antibody

Immunocytochemistry/ Immunofluorescence: EIF2B2 Antibody [NBP3-38367] -

Immunocytochemistry/ Immunofluorescence: EIF2B2 Antibody [NBP3-38367] - Immunofluorescence analysis of C6 cells using EIF2B2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
EIF2B2 Antibody

Immunohistochemistry: EIF2B2 Antibody [NBP3-38367] -

Immunohistochemistry: EIF2B2 Antibody [NBP3-38367] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using EIF2B2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
EIF2B2 Antibody

Immunohistochemistry: EIF2B2 Antibody [NBP3-38367] -

Immunohistochemistry: EIF2B2 Antibody [NBP3-38367] - Immunohistochemistry analysis of paraffin-embedded Rat lung using EIF2B2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
EIF2B2 Antibody

Immunocytochemistry/ Immunofluorescence: EIF2B2 Antibody [NBP3-38367] -

Immunocytochemistry/ Immunofluorescence: EIF2B2 Antibody [NBP3-38367] - Immunofluorescence analysis of NIH/3T3 cells using EIF2B2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
EIF2B2 Antibody

Immunohistochemistry: EIF2B2 Antibody [NBP3-38367] -

Immunohistochemistry: EIF2B2 Antibody [NBP3-38367] - Immunohistochemistry analysis of paraffin-embedded Human tonsil using EIF2B2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
EIF2B2 Antibody

Western Blot: EIF2B2 Antibody [NBP3-38367] -

Western Blot: EIF2B2 Antibody [NBP3-38367] - Western blot analysis of various lysates using EIF2B2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for EIF2B2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Immunoprecipitation

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: EIF2B2

Eukaryotic initiation factor-2B (EIF2B) is a GTP exchange protein essential for protein synthesis. It consists of alpha (EIF2B1; MIM 606686), beta (EIF2B2), gamma (EIF2B3; MIM 606273), delta (EIF2B4; MIM 606687), and epsilon (EIF2B5; MIM 603945) subunits. EIF2B activates its EIF2 (see MIM 603907) substrate by exchanging EIF2-bound GDP for GTP.[supplied by OMIM]

Alternate Names

EIF2B, eIF-2B GDP-GTP exchange factor subunit beta, EIF2BB, EIF-2Bbeta, eukaryotic translation initiation factor 2B, subunit 2 (beta, 39kD), eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa, S20I15, S20III15, translation initiation factor eIF-2B subunit beta

Gene Symbol

EIF2B2

Additional EIF2B2 Products

Product Documents for EIF2B2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EIF2B2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EIF2B2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EIF2B2 Antibody - BSA Free and earn rewards!

Have you used EIF2B2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...