EIF3F Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38366

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all EIF3F Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 88-357 of human EIF3F (NP_003745.1).

Sequence:
GGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for EIF3F Antibody - BSA Free

EIF3F Antibody

Immunohistochemistry: EIF3F Antibody [NBP3-38366] -

Immunohistochemistry: EIF3F Antibody [NBP3-38366] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using EIF3F Rabbit pAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
EIF3F Antibody

Western Blot: EIF3F Antibody [NBP3-38366] -

Western Blot: EIF3F Antibody [NBP3-38366] - Western blot analysis of lysates from HeLa cells, using EIF3F Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 60s.
EIF3F Antibody

Immunohistochemistry: EIF3F Antibody [NBP3-38366] -

Immunohistochemistry: EIF3F Antibody [NBP3-38366] - Immunohistochemistry analysis of EIF3F in paraffin-embedded Mouse spleen tissue using EIF3F Rabbit pAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
EIF3F Antibody

Immunocytochemistry/ Immunofluorescence: EIF3F Antibody [NBP3-38366] -

Immunocytochemistry/ Immunofluorescence: EIF3F Antibody [NBP3-38366] - Immunofluorescence analysis of NIH/3T3 cells using EIF3F Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
EIF3F Antibody

Immunocytochemistry/ Immunofluorescence: EIF3F Antibody [NBP3-38366] -

Immunocytochemistry/ Immunofluorescence: EIF3F Antibody [NBP3-38366] - Immunofluorescence analysis of PC-12 cells using EIF3F Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
EIF3F Antibody

Immunohistochemistry: EIF3F Antibody [NBP3-38366] -

Immunohistochemistry: EIF3F Antibody [NBP3-38366] - Immunohistochemistry analysis of EIF3F in paraffin-embedded Human pancreas tissue using EIF3F Rabbit pAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
EIF3F Antibody

Immunohistochemistry: EIF3F Antibody [NBP3-38366] -

Immunohistochemistry: EIF3F Antibody [NBP3-38366] - Immunohistochemistry analysis of EIF3F in paraffin-embedded Human colon tissue using EIF3F Rabbit pAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
EIF3F Antibody

Immunohistochemistry: EIF3F Antibody [NBP3-38366] -

Immunohistochemistry: EIF3F Antibody [NBP3-38366] - Immunohistochemistry analysis of EIF3F in paraffin-embedded Rat brain tissue using EIF3F Rabbit pAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for EIF3F Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/ml

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: EIF3F

eIF3f, also known as eukaryotic translation initiation factor 3 subunit 5, eIF-3 epsilon, and eIF3 p47 subunit, binds to the 40S ribosome and promotes the binding of methionyl-tRNA and mRNA. EIF3f also associates with the complex p170-eIF3. eIF-3 is composed of at least 12 different subunits, eIF3f is one of these subunits.

Alternate Names

eIF3 p47, eIF-3-epsilon, eIF3-epsilon, eIF3f, eIF3-p47, EIF3S5eukaryotic translation initiation factor 3 subunit F, Eukaryotic translation initiation factor 3 subunit 5, eukaryotic translation initiation factor 3, subunit 5 (epsilon, 47kD), eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa, eukaryotic translation initiation factor 3, subunit F

Gene Symbol

EIF3F

Additional EIF3F Products

Product Documents for EIF3F Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EIF3F Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EIF3F Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EIF3F Antibody - BSA Free and earn rewards!

Have you used EIF3F Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies