ENO3 Antibody (5D1) - Azide and BSA Free
Novus Biologicals | Catalog # H00002027-M01
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Rat, Bovine
Cited:
Bovine
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Dot Blot, Knockdown Validated
Cited:
Western Blot, Cytometric Bead Assay Standard
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2a Kappa Clone # 5D1
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
ENO3 (NP_001967, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG
Reactivity Notes
Bovine reactivity reported in multiple pieces of scientific literature.
Specificity
ENO3 - enolase 3 (beta, muscle)
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2a Kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for ENO3 Antibody (5D1) - Azide and BSA Free
Western Blot: ENO3 Antibody (5D1) [H00002027-M01]
Western Blot: ENO3 Antibody (5D1) [H00002027-M01] - Analysis of ENO3 expression in transfected 293T cell line by ENO3 monoclonal antibody (M01), clone 5D1.Lane 1: ENO3 transfected lysate(46.9 KDa).Lane 2: Non-transfected lysate.Immunocytochemistry/ Immunofluorescence: ENO3 Antibody (5D1) [H00002027-M01]
Immunocytochemistry/Immunofluorescence: ENO3 Antibody (5D1) [H00002027-M01] - Analysis of monoclonal antibody to ENO3 on HeLa cell. Antibody concentration 10 ug/ml.Immunohistochemistry-Paraffin: ENO3 Antibody (5D1) [H00002027-M01]
Immunohistochemistry-Paraffin: ENO3 Antibody (5D1) [H00002027-M01] - Analysis of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.Western Blot: ENO3 Antibody (5D1) [H00002027-M01]
Western Blot: ENO3 Antibody (5D1) [H00002027-M01] - Analysis of ENO3 over-expressed 293 cell line, cotransfected with ENO3 Validated Chimera RNAi ( Cat # H00002027-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ENO3 monoclonal antibody (M01), clone 5D1 (Cat # H00002027-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Western Blot: ENO3 Antibody (5D1) [H00002027-M01]
Western Blot: ENO3 Antibody (5D1) [H00002027-M01] - ENO3 monoclonal antibody (M01), clone 5D1 Analysis of ENO3 expression in HeLa.Immunohistochemistry-Paraffin: ENO3 Antibody (5D1) [H00002027-M01]
Immunohistochemistry-Paraffin: ENO3 Antibody (5D1) [H00002027-M01] - Analysis of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 1.5 ug/ml.ELISA: ENO3 Antibody (5D1) [H00002027-M01]
ELISA: ENO3 Antibody (5D1) [H00002027-M01] - Detection limit for recombinant GST tagged ENO3 is approximately 0.03ng/ml as a capture antibody.Applications for ENO3 Antibody (5D1) - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA. Use in Dot blot reported in scientific literature (PMID:26344128).
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: ENO3
Alternate Names
2-phospho-D-glycerate hydrolyase, 2-phospho-D-glycerate hydro-lyase, beta-enolase, EC 4.2.1, EC 4.2.1.11, Enolase 3, enolase 3 (beta, muscle), enolase 3, (beta, muscle), GSD13, MSE, Muscle-specific enolase, Skeletal muscle enolase
Entrez Gene IDs
2027 (Human)
Gene Symbol
ENO3
OMIM
131370 (Human)
UniProt
Additional ENO3 Products
Product Documents for ENO3 Antibody (5D1) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ENO3 Antibody (5D1) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for ENO3 Antibody (5D1) - Azide and BSA Free
Customer Reviews for ENO3 Antibody (5D1) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review ENO3 Antibody (5D1) - Azide and BSA Free and earn rewards!
Have you used ENO3 Antibody (5D1) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...