Enolase 2/Neuron-specific Enolase Antibody (NSEP2) - BSA Free
Novus Biologicals | Catalog # NBP2-50533
Key Product Details
Species Reactivity
Applications
Label
Antibody Source
Format
Product Specifications
Immunogen
Specificity
Clonality
Host
Isotype
Scientific Data Images for Enolase 2/Neuron-specific Enolase Antibody (NSEP2) - BSA Free
Western Blot: Enolase 2/Neuron-specific Enolase Antibody (NSEP2)BSA Free [NBP2-50533]
Western Blot: Enolase 2/Neuron-specific Enolase Antibody (NSEP2) [NBP2-50533] - Lysates were separated on SDS-PAGE and probed with Anti-NSE [NSE-P2]. Lane 1: SH-SY5Y, Lane 2: NT2/D1.Applications for Enolase 2/Neuron-specific Enolase Antibody (NSEP2) - BSA Free
ELISA
Immunohistochemistry
Western Blot
Formulation, Preparation, and Storage
Purification
Formulation
Format
Preservative
Concentration
Shipping
Stability & Storage
Background: Enolase 2/Neuron-specific Enolase
Alternate Names
Gene Symbol
Additional Enolase 2/Neuron-specific Enolase Products
Product Documents for Enolase 2/Neuron-specific Enolase Antibody (NSEP2) - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Enolase 2/Neuron-specific Enolase Antibody (NSEP2) - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Enolase 2/Neuron-specific Enolase Antibody (NSEP2) - BSA Free
There are currently no reviews for this product. Be the first to review Enolase 2/Neuron-specific Enolase Antibody (NSEP2) - BSA Free and earn rewards!
Have you used Enolase 2/Neuron-specific Enolase Antibody (NSEP2) - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for Enolase 2/Neuron-specific Enolase Antibody (NSEP2) - BSA Free
-
Q: Enolase came up as a candidate in mass spec. There are at least three isoforms which showed up once or twice or three times (as in three mass spec repeats). To validate the mass data, we are looking into quantitate each isoform. Which antibodies are specific for each of the three?
A: We checked all antibodies to Enolase 1, Enolase 2 and Enolase 3, but unfortunately no cross reactivity testing was performed for any of these antibodies. Considering how similar these proteins are, it is reasonable to expect some of them will react with other enolases. Base on immunogen sequence, we found some that were raised to the most diverse regions between these proteins, so it is possible that these will be the most specific to the protein they were raised to.
For Enolase 1, your best bet is NBP2-25147 as it was raised to N terminal peptide of bovine Eno1: MSILKVHAREIF
For Enolase 2, I found 3 candidate antibodies:
NBP2-53158 and NBP2-50532 were raised to aa416-433 (ELGDEARFAGHNFRNPSVL) - it says these antibodies are only reactive with human but they will also work for mouse since the immunogen is 100% match
NBP2-50533, which was raised to aa271-285 (GDQLGALYQDFVRD) - which is also likely to react with mouse, the immunogen is 93% match with mouse (only last aminoacid is different)
For Enolase 3, your best bet would be H00002027-M01 or H00002027-A01. both were raised to aa228-277 (KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG) - 98% match to mouse
The immunogens for all these antibodies fall into most variable regions, however, since we have not performed crossreactivity testing, we can not guarantee that they will not crossreact to some extent.