ENOSF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13962

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: QHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKEESVKKHQYPDGEVWKK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ENOSF1 Antibody - BSA Free

Western Blot: ENOSF1 Antibody [NBP2-13962]

Western Blot: ENOSF1 Antibody [NBP2-13962]

Western Blot: ENOSF1 Antibody [NBP2-13962] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: ENOSF1 Antibody [NBP2-13962]

Immunohistochemistry-Paraffin: ENOSF1 Antibody [NBP2-13962]

Immunohistochemistry-Paraffin: ENOSF1 Antibody [NBP2-13962] - Staining in human kidney and ovary tissues using anti-ENOSF1 antibody. Corresponding ENOSF1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ENOSF1 Antibody [NBP2-13962]

Immunohistochemistry-Paraffin: ENOSF1 Antibody [NBP2-13962]

Immunohistochemistry-Paraffin: ENOSF1 Antibody [NBP2-13962] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: ENOSF1 Antibody [NBP2-13962]

Immunohistochemistry-Paraffin: ENOSF1 Antibody [NBP2-13962]

Immunohistochemistry-Paraffin: ENOSF1 Antibody [NBP2-13962] - Staining of human ovary shows low expression as expected.

Applications for ENOSF1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ENOSF1

The rTS gene codes for a naturally occurring antisense RNA to thymidylate synthase (TS) mRNA and two proteins (rTSalpha and rTSbeta (also known as ENOSF1)). The role of the major protein product of rTS, ENOSF1 has been linked to alterations in TS protein expression, but the precise function of ENOSF1 is unknown. Expression of rTS is associated with growth arrest in cell culture, but its overexpression has been noted in cells resistant to anticancer drugs such as 5-fluorouracil and methotrexate. Studies have shown that increased expression of ENOSF1 is associated with the decrease in TS protein expression due to production of novel, diffusible signal molecules.

Alternate Names

Antisense RNA to thymidylate synthase, EC 5.-, enolase superfamily member 1, HSRTSBETA, rTS, rTS beta, RTSrTS alpha, TYMSASmitochondrial enolase superfamily member 1

Gene Symbol

ENOSF1

Additional ENOSF1 Products

Product Documents for ENOSF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ENOSF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ENOSF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ENOSF1 Antibody - BSA Free and earn rewards!

Have you used ENOSF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...