Ephrins are naturally divided into two structural groups. All ligands share a conserved extracellular sequence, which most likely corresponds to the receptor-binding domain. This conserved sequence consists of approximately 125 amino acids and includes four invariant cysteines. The B-class ligands are transmembrane proteins, which can be tyrosine phosphorylated upon receptor ligation. Class B ephrins show 33% amino acid sequence identity in their extracellular segments and 44% amino acid sequence identity in their cytoplasmic regions.
Ephrin-B2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-84830
Loading...
Key Product Details
Validated by
Biological Validation
Species Reactivity
Validated:
Human
Cited:
Human, Mouse, Rat
Predicted:
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Western Blot, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMP
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Ephrin-B2 Antibody - BSA Free
Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830]
Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830] - Staining of human placenta shows moderate membranous positivity in endothelial cells.Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830]
Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830] - Staining of human colon shows weak to moderate membranous positivity in glandular cells.Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830]
Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli.Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830]
Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830] - Staining of human lung shows weak to moderate membranous positivity in pneumocytes.Western Blot: Ephrin-B2 Antibody [NBP1-84830] -
Western Blot: Ephrin-B2 Antibody [NBP1-84830] - Colonic levels of EphB4 & ephrin-B2 mRNA. (A) Representative agarose gels showing mRNA levels of EphB4, ephrin-B2 & GAPDH from the colon of vehicle-treated normal mice (N; n = 7) & of TNBS-treated mice administered with vehicle (CNT; n = 4) or EphB4 20 µg/kg (EphB; n = 5). Histograms represent the quantification of EphB4 (B) & ephrin-B2 (C) mRNA levels normalized to GAPDH amplification products. Transcript X1 (black bars) & transcript X2 (white bars), encoded by ephrin-B2 gene, were detected & represented (C). Data are shown as mean ± SEM. *P < 0.05 vs. N mice, one-way ANOVA followed by Bonferroni’s post-test. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31297055), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: Ephrin-B2 Antibody - BSA Free [NBP1-84830]
Analysis in human cell line HEK 293.Applications for Ephrin-B2 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50-1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Ephrin-B2
Alternate Names
EFNB2, ELF-2, EphrinB2, Htk-L, LERK-5, NLERK-1
Gene Symbol
EFNB2
Additional Ephrin-B2 Products
Product Documents for Ephrin-B2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Ephrin-B2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Ephrin-B2 Antibody - BSA Free
Customer Reviews for Ephrin-B2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Ephrin-B2 Antibody - BSA Free and earn rewards!
Have you used Ephrin-B2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...