EQTN Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90869

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SCESQYSVNPELATMSYFHPSEGVSDTSFSKSAESSTFLGTTSSDMRRSGTRTSESKIMTDIISIGSDNEMHENDESVTR

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23276153)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for EQTN Antibody - BSA Free

Western Blot: EQTN Antibody [NBP1-90869]

Western Blot: EQTN Antibody [NBP1-90869]

Western Blot: C9orf11 Antibody [NBP1-90869] - Analysis in control (vector only transfected HEK293T lysate) and EQTN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
EQTN Antibody - BSA Free Western Blot: EQTN Antibody - BSA Free [NBP1-90869]

Western Blot: EQTN Antibody - BSA Free [NBP1-90869]

Analysis in control (vector only transfected HEK293T lysate) and EQTN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
EQTN Antibody - BSA Free Immunohistochemistry-Paraffin: EQTN Antibody [NBP1-90869]

Immunohistochemistry-Paraffin: EQTN Antibody [NBP1-90869]

Analysis in human testis and prostate tissues. Corresponding RNA-seq data are presented for the same tissues.
EQTN Antibody - BSA Free Immunohistochemistry-Paraffin: EQTN Antibody [NBP1-90869]

Immunohistochemistry-Paraffin: EQTN Antibody [NBP1-90869]

Staining of human testis shows strong positivity in cells in seminiferous ducts.
EQTN Antibody - BSA Free Immunohistochemistry-Paraffin: EQTN Antibody [NBP1-90869]

Immunohistochemistry-Paraffin: EQTN Antibody [NBP1-90869]

Staining of human liver shows no positivity in hepatocytes as expected.
EQTN Antibody - BSA Free Immunohistochemistry-Paraffin: EQTN Antibody [NBP1-90869]

Immunohistochemistry-Paraffin: EQTN Antibody [NBP1-90869]

Staining of human prostate shows no positivity in glandular cells as expected.
EQTN Antibody - BSA Free Immunohistochemistry-Paraffin: EQTN Antibody [NBP1-90869]

Immunohistochemistry-Paraffin: EQTN Antibody [NBP1-90869]

Staining of human colon shows no positivity in glandular cells as expected.
EQTN Antibody - BSA Free Immunohistochemistry-Paraffin: EQTN Antibody [NBP1-90869]

Immunohistochemistry-Paraffin: EQTN Antibody [NBP1-90869]

Staining of human colon, liver, prostate and testis HPA015089 (A) shows similar protein distribution across tissues to independent antibody HPA015504 (B).

Applications for EQTN Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EQTN

Alternate Names

acrosome formation associated factor, acrosome formation-associated factor, AFAF, C9orf11, chromosome 9 open reading frame 11, equatorin, equatorin, sperm acrosome associated, SPACA8

Gene Symbol

EQTN

Additional EQTN Products

Product Documents for EQTN Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EQTN Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for EQTN Antibody - BSA Free

Customer Reviews for EQTN Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EQTN Antibody - BSA Free and earn rewards!

Have you used EQTN Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...