ERGIC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83962

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PGNFHVSTHSATAQPQNPDMTHVIHKLSFGDTLQVQNIHGAFNALGGADRLTSNPLASHDYIL

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ERGIC1 Antibody - BSA Free

Western Blot: ERGIC1 Antibody [NBP1-83962]

Western Blot: ERGIC1 Antibody [NBP1-83962]

Western Blot: ERGIC1 Antibody [NBP1-83962] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17
Lane 2: Human cell line RT-4
Lane 3: Human cell line EFO-23
Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962]

Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962]

Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: ERGIC1 Antibody [NBP1-83962]

Western Blot: ERGIC1 Antibody [NBP1-83962]

Western Blot: ERGIC1 Antibody [NBP1-83962] - Analysis in control (vector only transfected HEK293T lysate) and ERGIC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962]

Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962]

Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962]

Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962]

Immunohistochemistry-Paraffin: ERGIC1 Antibody [NBP1-83962] - Staining of human cerebral cortex, liver, prostate and testis using Anti-ERGIC1 antibody NBP1-83962 (A) shows similar protein distribution across tissues to independent antibody NBP1-83963 (B).
ERGIC1 Antibody - BSA Free Immunohistochemistry-Paraffin: ERGIC1 Antibody - BSA Free [NBP1-83962]

Immunohistochemistry-Paraffin: ERGIC1 Antibody - BSA Free [NBP1-83962]

Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
ERGIC1 Antibody - BSA Free Immunohistochemistry-Paraffin: ERGIC1 Antibody - BSA Free [NBP1-83962]

Immunohistochemistry-Paraffin: ERGIC1 Antibody - BSA Free [NBP1-83962]

Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells) and glandular cells).
ERGIC1 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: ERGIC1 Antibody [NBP1-83962]

Immunocytochemistry/ Immunofluorescence: ERGIC1 Antibody [NBP1-83962]

Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.

Applications for ERGIC1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ERGIC1

ERGIC1 encodes a cycling membrane protein which is an endoplasmic reticulum-golgi intermediate compartment (ERGIC) protein which interacts with other members of this protein family to increase their turnover. [provided by RefSeq]

Alternate Names

endoplasmic reticulum-golgi intermediate compartment (ERGIC) 1, endoplasmic reticulum-Golgi intermediate compartment protein 1, ERGIC-32FLJ39864, ERGIC32MGC14345, ER-Golgi intermediate compartment 32 kDa protein, KIAA1181endoplasmic reticulum-golgi intermediate compartment 32 kDa protein, NET24

Gene Symbol

ERGIC1

Additional ERGIC1 Products

Product Documents for ERGIC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ERGIC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ERGIC1 Antibody - BSA Free

Customer Reviews for ERGIC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ERGIC1 Antibody - BSA Free and earn rewards!

Have you used ERGIC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...