EWSR1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49380

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all EWSR1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for EWSR1 Antibody - BSA Free

Western Blot: EWSR1 Antibody [NBP2-49380]

Western Blot: EWSR1 Antibody [NBP2-49380]

Western Blot: EWSR1 Antibody [NBP2-49380] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
Lane 4: Human plasma
Lane 5: Human Liver tissue
Lane 6: Human Tonsil tissue
Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380]

Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380]

Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining of human skin.
Immunohistochemistry: EWSR1 Antibody [NBP2-49380]

Immunohistochemistry: EWSR1 Antibody [NBP2-49380]

Immunohistochemistry: EWSR1 Antibody [NBP2-49380] - Staining of human colon shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380]

Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380]

Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380]

Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380]

Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380]

Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380]

Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining in human testis and skeletal muscle tissues using anti-EWSR1 antibody. Corresponding EWSR1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380]

Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380]

Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining of human colon, liver, skin and testis using Anti-EWSR1 antibody NBP2-49380 (A) shows similar protein distribution across tissues to independent antibody NBP2-49020 (B).
Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380]

Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380]

Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining of human liver.
Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380]

Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380]

Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-49380] - Staining of human colon.

Applications for EWSR1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EWSR1

The EWSR1 gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal

Long Name

RNA-binding protein EWS

Alternate Names

EWS, EWS oncogene

Gene Symbol

EWSR1

Additional EWSR1 Products

Product Documents for EWSR1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EWSR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EWSR1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EWSR1 Antibody - BSA Free and earn rewards!

Have you used EWSR1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies