FARP1 Antibody (2D4) - Azide and BSA Free

Novus Biologicals | Catalog # H00010160-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2D4

Format

Azide and BSA Free
View all FARP1 Primary Antibodies »

Product Specifications

Immunogen

FARP1 (NP_005757.1, 471 a.a. ~ 549 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TGSLTGSPHLSELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDEGRRKRFPTDKAYFIAKEVS

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:35262173).

Specificity

FARP1 - FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived) (2D4)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for FARP1 Antibody (2D4) - Azide and BSA Free

Western Blot: FARP1 Antibody (2D4) [H00010160-M01]

Western Blot: FARP1 Antibody (2D4) [H00010160-M01]

Western Blot: FARP1 Antibody (2D4) [H00010160-M01] - WB validation of FARP1 monoclonal antibody (clone M01) against its immunogen (partial recombinant protein AA 471 - 549 with GST tag, 34.43 KDa; MW of the GST tag alone is 26 KDa).
Immunocytochemistry/ Immunofluorescence: FARP1 Antibody (2D4) [H00010160-M01]

Immunocytochemistry/ Immunofluorescence: FARP1 Antibody (2D4) [H00010160-M01]

Immunocytochemistry/Immunofluorescence: FARP1 Antibody (2D4) [H00010160-M01] - Analysis of monoclonal antibody to FARP1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: FARP1 Antibody (2D4) [H00010160-M01]

Immunohistochemistry-Paraffin: FARP1 Antibody (2D4) [H00010160-M01]

FARP1-Antibody-2D4-Immunohistochemistry-Paraffin-H00010160-M01-img0005.jpg
FARP1 Antibody (2D4)

Immunohistochemistry: FARP1 Antibody (2D4) [H00010160-M01] -

Immunohistochemistry: FARP1 Antibody (2D4) [H00010160-M01] - High expression of FARP1 is associated with poor prognosis in gastric cancer.a List of Rho GEF genes significantly correlated with poor prognosis of patients with gastric cancer. b Relationship between FARP1 expression & overall survival of patients with gastric cancer as assessed using the Kaplan–Meier plotter. c Gene expression of FARP1 in solid normal tissue & primary gastric cancer. Magnification, ×200; scale bar, 200 μm. d Intensity of anti-FARP1 staining in the cytoplasm of gastric cancer cells. e Overall survival of patients with gastric cancer within high & low FARP1 expression grouped according to immunohistochemistry assessment. Survival rates were calculated by the Kaplan–Meier method, & differences in survival were estimated by the log-rank test. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32029704), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for FARP1 Antibody (2D4) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: FARP1

This gene was originally isolated through subtractive hybridization due to its increased expression in differentiated chondrocytes versus dedifferentiated chondrocytes. The resulting protein contains a predicted ezrin-like domain, a Dbl homology domain, and a pleckstrin homology domain. It is believed to be a member of the band 4.1 superfamily whose members link the cytoskeleton to the cell membrane. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq]

Long Name

FERM, ARHGEF and pleckstrin domain-containing protein 1

Alternate Names

CDEP, PLEKHC2

Entrez Gene IDs

10160 (Human)

Gene Symbol

FARP1

UniProt

NP_005757 (Human)

Additional FARP1 Products

Product Documents for FARP1 Antibody (2D4) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FARP1 Antibody (2D4) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for FARP1 Antibody (2D4) - Azide and BSA Free

Customer Reviews for FARP1 Antibody (2D4) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review FARP1 Antibody (2D4) - Azide and BSA Free and earn rewards!

Have you used FARP1 Antibody (2D4) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies