Fast skeletal myosin light chain 1 Antibody (2D9) - Azide and BSA Free

Novus Biologicals | Catalog # H00004632-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Sandwich ELISA, Knockdown Validated

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2D9

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

MYL1 (NP_524146, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNK

Specificity

MYL1 (2D9)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images

Western Blot: Fast skeletal myosin light chain 1 Antibody (2D9) [H00004632-M01]

Western Blot: Fast skeletal myosin light chain 1 Antibody (2D9) [H00004632-M01]

Western Blot: Fast skeletal myosin light chain 1 Antibody (2D9) [H00004632-M01] - Analysis of MYL1 expression in transfected 293T cell line by MYL1 monoclonal antibody (M01), clone 2D9.Lane 1: MYL1 transfected lysate(21.1 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: Fast skeletal myosin light chain 1 Antibody (2D9) [H00004632-M01]

Immunohistochemistry-Paraffin: Fast skeletal myosin light chain 1 Antibody (2D9) [H00004632-M01]

Immunohistochemistry-Paraffin: Fast skeletal myosin light chain 1 Antibody (2D9) [H00004632-M01] - Analysis of monoclonal antibody to MYL1 on formalin-fixed paraffin-embedded human spleen. Antibody concentration 3 ug/ml.
Western Blot: Fast skeletal myosin light chain 1 Antibody (2D9) [H00004632-M01]

Western Blot: Fast skeletal myosin light chain 1 Antibody (2D9) [H00004632-M01]

Western Blot: Fast skeletal myosin light chain 1 Antibody (2D9) [H00004632-M01] - Analysis of MYL1 over-expressed 293 cell line, cotransfected with MYL1 Validated Chimera RNAi ( Cat # H00004632-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MYL1 monoclonal antibody (M01), clone 2D9 (Cat # H00004632-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Sandwich ELISA: Fast skeletal myosin light chain 1 Antibody (2D9) [H00004632-M01] - Detection limit for recombinant GST tagged MYL1 is approximately 3ng/ml as a capture antibody.

Applications

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P, RNAi Validation and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Fast skeletal myosin light chain 1

Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene.

Alternate Names

A1 catalytic, A2 catalytic, MLC1/MLC3, MLC1F, MLC1F/MLC3F, MLC3F, myosin light chain 1/3, skeletal muscle isoform, Myosin light chain A1/A2, Myosin light chain alkali 1/2, myosin, light chain 1, alkali; skeletal, fast, myosin, light polypeptide 1, alkali; skeletal, fast

Entrez Gene IDs

4632 (Human)

Gene Symbol

MYL1

OMIM

160780 (Human)

Additional Fast skeletal myosin light chain 1 Products

Product Documents

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews

There are currently no reviews for this product. Be the first to review Fast skeletal myosin light chain 1 Antibody (2D9) - Azide and BSA Free and earn rewards!

Have you used Fast skeletal myosin light chain 1 Antibody (2D9) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...