Fatty Acid Synthase/FASN Antibody (4U9S3)
Novus Biologicals | Catalog # NBP3-15634
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 4U9S3 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 2400-2500 of human FASN (P49327). AVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSS
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
273 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Fatty Acid Synthase/FASN Antibody (4U9S3)
Western Blot: Fatty Acid Synthase/FASN Antibody (4U9S3) [NBP3-15634]
Western Blot: Fatty Acid Synthase/FASN Antibody (4U9S3) [NBP3-15634] - Analysis of extracts of various cell lines, using Fatty Acid Synthase/FASN antibody (NBP3-15634) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.Immunoprecipitation: Fatty Acid Synthase/FASN Antibody (4U9S3) [NBP3-15634]
Immunoprecipitation: Fatty Acid Synthase/FASN Antibody (4U9S3) [NBP3-15634] - Analysis of 300ug extracts of HeLa cells using 3ug Fatty Acid Synthase/FASN antibody (NBP3-15634). Western blot was performed from the immunoprecipitate using Fatty Acid Synthase/FASN antibody (NBP3-15634) at a dilition of 1:500.Immunohistochemistry: Fatty Acid Synthase/FASN Antibody (4U9S3) [Fatty Acid Synthase/FASN] -
Immunohistochemistry: Fatty Acid Synthase/FASN Antibody (4U9S3) [Fatty Acid Synthase/FASN] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Fatty Acid Synthase/FASN Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.Immunocytochemistry/ Immunofluorescence: Fatty Acid Synthase/FASN Antibody (4U9S3) [NBP3-15634]
Immunocytochemistry/Immunofluorescence: Fatty Acid Synthase/FASN Antibody (4U9S3) [NBP3-15634] - Analysis of NIH-3T3 cells using Fatty Acid Synthase/FASN Rabbit mAb (NBP3-15634) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: Fatty Acid Synthase/FASN Antibody (4U9S3) [Fatty Acid Synthase/FASN] -
Immunocytochemistry/ Immunofluorescence: Fatty Acid Synthase/FASN Antibody (4U9S3) [Fatty Acid Synthase/FASN] - Immunofluorescence analysis of HeLa cells using Fatty Acid Synthase/FASN Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Immunohistochemistry: Fatty Acid Synthase/FASN Antibody (4U9S3) [Fatty Acid Synthase/FASN] -
Immunohistochemistry: Fatty Acid Synthase/FASN Antibody (4U9S3) [Fatty Acid Synthase/FASN] - Immunohistochemistry analysis of paraffin-embedded Mouse skin tissue using Fatty Acid Synthase/FASN Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.Immunohistochemistry: Fatty Acid Synthase/FASN Antibody (4U9S3) [Fatty Acid Synthase/FASN] -
Immunohistochemistry: Fatty Acid Synthase/FASN Antibody (4U9S3) [Fatty Acid Synthase/FASN] - Immunohistochemistry analysis of paraffin-embedded Rat fat tissue using Fatty Acid Synthase/FASN Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.Immunohistochemistry: Fatty Acid Synthase/FASN Antibody (4U9S3) [Fatty Acid Synthase/FASN] -
Immunohistochemistry: Fatty Acid Synthase/FASN Antibody (4U9S3) [Fatty Acid Synthase/FASN] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using Fatty Acid Synthase/FASN Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.Applications for Fatty Acid Synthase/FASN Antibody (4U9S3)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL
Immunocytochemistry/ Immunofluorescence
1:100 - 1:800
Immunohistochemistry
1:500 - 1:2000
Immunohistochemistry-Paraffin
1:500 - 1:2000
Immunoprecipitation
0.5 μg - 4 μg antibody for 200 μg - 400 μg extracts of whole cells
Western Blot
1:3000 - 1:12000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Fatty Acid Synthase/FASN
In some cancer cell lines, FAS has been found to be fused with ER-alpha. Therefore, FAS antibodies are useful tools for studies on fatty acid synthesis and research on certian cancers.
Alternate Names
FASN, OA-519, SDR27X1
Gene Symbol
FASN
Additional Fatty Acid Synthase/FASN Products
Product Documents for Fatty Acid Synthase/FASN Antibody (4U9S3)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Fatty Acid Synthase/FASN Antibody (4U9S3)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Fatty Acid Synthase/FASN Antibody (4U9S3)
There are currently no reviews for this product. Be the first to review Fatty Acid Synthase/FASN Antibody (4U9S3) and earn rewards!
Have you used Fatty Acid Synthase/FASN Antibody (4U9S3)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...