FCRN/FCGRT Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89128

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human, Primate - Macaca fascicularis (Crab-eating Monkey or Cynomolgus Macaque)

Applications

Validated:

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Cited:

Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for FCRN/FCGRT Antibody - BSA Free

Knockout Validated: FCRN/FCGRT Antibody [NBP1-89128]

Western Blot: FCRN/FCGRT Antibody [NBP1-89128]

Western Blot: FCRN/FCGRT Antibody [NBP1-89128] - Western blot shows lysates of 293 human embryonic kidney parental cell line and FCGRT knockout (KO) 293 cell line. PVDF membrane was probed with 1:500 of Rabbit Anti-Human FCGRT Polyclonal Antibody (Catalog # NBP1-89128) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for FCGRT at approximately 40 kDa (as indicated) in the parental 293 cell line, but is not detectable in the knockout 293 cell line. This experiment was conducted under reducing conditions.
Western Blot: FCRN/FCGRT Antibody [NBP1-89128]

Western Blot: FCRN/FCGRT Antibody [NBP1-89128]

Western Blot: FCRN/FCGRT Antibody [NBP1-89128] - Analysis in human cell lines Caco-2 and HeLa using anti-FCGRT antibody. Corresponding FCGRT RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Western Blot: FCRN/FCGRT Antibody [NBP1-89128]

Western Blot: FCRN/FCGRT Antibody [NBP1-89128]

FCRN-FCGRT-Antibody-Western-Blot-NBP1-89128-img0029.jpg
Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128]

Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128]

Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Staining in human placental Hoffbauer cells at a 1:65 dilution. Image from a verified customer review.
Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128]

Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128]

Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in Kupffer cells.
Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128]

Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128]

Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Immunohistochemical staining of human cerebellum shows no positivity in neuronal cells as expected.
Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128]

Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128]

Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Staining of human placenta shows moderate to strong cytoplasmic positivity in Hofbauer cells.
Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128]

Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128]

Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Simple Western: FCRN/FCGRT Antibody [NBP1-89128]

Simple Western: FCRN/FCGRT Antibody [NBP1-89128]

Simple Western: FCRN/FCGRT Antibody [NBP1-89128] - Simple Western lane view shows a specific band for FCGRT in 0.2 mg/ml of h. Liver (left), HepG2 (middle) and THP-1 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: FCRN/FCGRT Antibody [NBP1-89128]

Simple Western: FCRN/FCGRT Antibody [NBP1-89128]

Simple Western: FCRN/FCGRT Antibody [NBP1-89128] - Electropherogram image(s) of corresponding Simple Western lane view. FCRN/FCGRT antibody was used at 1:20 dilution on h. Liver, HepG2, and THP-1 lysate(s).
FCRN/FCGRT Antibody - BSA Free

Immunohistochemistry: FCRN/FCGRT Antibody - BSA Free [NBP1-89128] -

Expression of FcRn in non-cancerous A. and cancerous B. serial lung sections from a small set of patients (n=8)(A) FcRn expression was very week in bronchial epithelial cells (left panel) and marked in alveolar macrophages (right panel) in the non-cancerous lung. (B) In cancerous tissue, the staining revealed that FcRn is expressed in interstitial stromal cells including DCs (PS100), macrophages (CD163) (arrowheads indicate areas of colocalization) but no CD8+ T cells (CD8). A very weak staining was also observed in carcinomatous cells. Pictures from 3 patients were selected as they are representative of the different staining. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/27384673), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
FCRN/FCGRT Antibody - BSA Free

Immunohistochemistry: FCRN/FCGRT Antibody - BSA Free [NBP1-89128] -

Expression of FcRn in non-cancerous A. and cancerous B. serial lung sections from a small set of patients (n=8)(A) FcRn expression was very week in bronchial epithelial cells (left panel) and marked in alveolar macrophages (right panel) in the non-cancerous lung. (B) In cancerous tissue, the staining revealed that FcRn is expressed in interstitial stromal cells including DCs (PS100), macrophages (CD163) (arrowheads indicate areas of colocalization) but no CD8+ T cells (CD8). A very weak staining was also observed in carcinomatous cells. Pictures from 3 patients were selected as they are representative of the different staining. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/27384673), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for FCRN/FCGRT Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Simple Western

1:20

Western Blot

0.04 - 0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in h. Liver, HepG2 (middle) and THP-1, separated by Size, antibody dilution of 1:20, apparent MW was 51, 44 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue

Reviewed Applications

Read 2 reviews rated 4.5 using NBP1-89128 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FCRN

The FCGRT gene encodes a 365 amino acid long, 39 kDA IgG receptor FcRn large subunit p51 protein that transfers immunoglobulin G antibodies across the placenta from mother to fetus, as well as functions to protect the antibody from degradation. FCGRT interacts with genes CA6, ELANE, AZGP1, B2M, and ALB. It has been linked to diseases such as: lupus, nephritis, leukemia, arthritis, immunodeficiency, epidermolysis bullosa acquisita, persistent fetal circulation syndrome, and pemphigus.

Long Name

Neonatal Fc Receptor

Alternate Names

FCGRT

Entrez Gene IDs

2217 (Human)

Gene Symbol

FCGRT

UniProt

Additional FCRN Products

Product Documents for FCRN/FCGRT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FCRN/FCGRT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for FCRN/FCGRT Antibody - BSA Free

Customer Reviews for FCRN/FCGRT Antibody - BSA Free (2)

4.5 out of 5
2 Customer Ratings
5 Stars
50%
4 Stars
50%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used FCRN/FCGRT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 2 的 2 reviews Showing All
Filter By:
  • FCRN/FCGRT Antibody
    Name: Jason Ray
    Application: Western Blot
    Sample Tested: HepG2
    Species: Human
    Verified Customer | Posted 10/16/2019
    Antibody was able to visualize endogenous FcRn (first lane), an FcRn-GFP fusion protein (middle lane), and a recombinant, shortened version of FcRn (third lane), with some background.
    FCRN/FCGRT Antibody - BSA Free NBP1-89128
  • Name: Corey.
    Application: Immunohistochemistry-Paraffin
    Sample Tested: Penile urethra and placental tissue
    Species: Human
    Verified Customer | Posted 12/04/2012
    Human Placental Hoffbauer cells at a 1:65 dilution.
    FCRN/FCGRT Antibody - BSA Free NBP1-89128

There are no reviews that match your criteria.

Showing  1 - 2 的 2 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FCRN/FCGRT Antibody - BSA Free

Showing  1 - 1 的 1 FAQ Showing All
  • Q: I use the anti-FcRn (Ref #NBP1-89128) and I was wondering if you have any clue about the nature of the higher slight band that we can see on the datasheet. Is it an isoform ?

    A: The theoretical molecular weight of FCGRT is ~39.7kDa. We typically see this antibody run true to size, as although there is a signal peptide lost, there is a glycoslation site that will make up for the lost weight. In our image on our datasheet, lane 3 is the FCGRT protein co-expressed with a C- terminal myc-DDK tag, which is why we are seeing the faint signal ~3kDa above the protein of interest.

Showing  1 - 1 的 1 FAQ Showing All
View all FAQs for Antibodies
Loading...