Flotillin-1 Antibody (8I2S7)

Novus Biologicals | Catalog # NBP3-16152

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8I2S7 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 328-427 of human Flotillin-1 (O75955). GARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVNHKPLRTA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Flotillin-1 Antibody (8I2S7)

Western Blot: Flotillin-1 Antibody (8I2S7) [NBP3-16152]

Western Blot: Flotillin-1 Antibody (8I2S7) [NBP3-16152]

Western Blot: Flotillin-1 Antibody (8I2S7) [NBP3-16152] - Analysis of extracts of various cell lines, using Flotillin-1 Rabbit mAb (NBP3-16152) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: Flotillin-1 Antibody (8I2S7) [NBP3-16152]

Western Blot: Flotillin-1 Antibody (8I2S7) [NBP3-16152]

Western Blot: Flotillin-1 Antibody (8I2S7) [NBP3-16152] - Analysis of extracts of various cell lines, using Flotillin-1 Rabbit mAb (NBP3-16152) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Flotillin-1 Antibody (8I2S7)

Immunohistochemistry: Flotillin-1 Antibody (8I2S7) [NBP3-16152] -

Immunohistochemistry: Flotillin-1 Antibody (8I2S7) [NBP3-16152] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using Flotillin-1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Flotillin-1 Antibody (8I2S7)

Immunohistochemistry: Flotillin-1 Antibody (8I2S7) [NBP3-16152] -

Immunohistochemistry: Flotillin-1 Antibody (8I2S7) [NBP3-16152] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Flotillin-1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Flotillin-1 Antibody (8I2S7)

Immunohistochemistry: Flotillin-1 Antibody (8I2S7) [NBP3-16152] -

Immunohistochemistry: Flotillin-1 Antibody (8I2S7) [NBP3-16152] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using Flotillin-1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for Flotillin-1 Antibody (8I2S7)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Flotillin-1

Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. FLOT1 encodes a caveolae-associated, integral membrane protein. The function of flotillin 1 has not been determined.

Alternate Names

flotillin 1, flotillin-1, integral membrane component of caveolae

Gene Symbol

FLOT1

Additional Flotillin-1 Products

Product Documents for Flotillin-1 Antibody (8I2S7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Flotillin-1 Antibody (8I2S7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Flotillin-1 Antibody (8I2S7)

There are currently no reviews for this product. Be the first to review Flotillin-1 Antibody (8I2S7) and earn rewards!

Have you used Flotillin-1 Antibody (8I2S7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...