Follistatin-related Gene Protein/FLRG/Fstl3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32034

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Follistatin-related Gene Protein/FLRG/Fstl3 Antibody - BSA Free (NBP2-32034) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Follistatin-related Gene Protein/FLRG/Fstl3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Follistatin-related Gene Protein/FLRG/Fstl3 Antibody [NBP2-32034]

Immunocytochemistry/ Immunofluorescence: Follistatin-related Gene Protein/FLRG/Fstl3 Antibody [NBP2-32034]

Immunocytochemistry/Immunofluorescence: Follistatin-related Gene Protein/FLRG/Fstl3 Antibody [NBP2-32034] - Staining of human cell line A549 shows localization to nucleoplasm. Antibody staining is shown in green.
Follistatin-related Gene Protein/FLRG/Fstl3 Antibody Follistatin-related Gene Protein/FLRG/Fstl3 Antibody

Follistatin-related Gene Protein/FLRG/Fstl3 Antibody [NBP2-32034] - Staining of human placenta shows strong nuclear positivity in a subset of trophoblastic cells.

Follistatin-related Gene Protein/FLRG/Fstl3 Antibody [NBP2-32034] - Staining of human placenta shows strong nuclear positivity in a subset of trophoblastic cells.
Follistatin-related Gene Protein/FLRG/Fstl3 Antibody Follistatin-related Gene Protein/FLRG/Fstl3 Antibody

Follistatin-related Gene Protein/FLRG/Fstl3 Antibody [NBP2-32034] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Follistatin-related Gene Protein/FLRG/Fstl3 Antibody [NBP2-32034] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Follistatin-related Gene Protein/FLRG/Fstl3 Antibody Follistatin-related Gene Protein/FLRG/Fstl3 Antibody

Follistatin-related Gene Protein/FLRG/Fstl3 Antibody [NBP2-32034] - Staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells.

Follistatin-related Gene Protein/FLRG/Fstl3 Antibody [NBP2-32034] - Staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells.
Follistatin-related Gene Protein/FLRG/Fstl3 Antibody Follistatin-related Gene Protein/FLRG/Fstl3 Antibody

Follistatin-related Gene Protein/FLRG/Fstl3 Antibody [NBP2-32034] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Follistatin-related Gene Protein/FLRG/Fstl3 Antibody [NBP2-32034] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for Follistatin-related Gene Protein/FLRG/Fstl3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Follistatin-related Gene Protein/FLRG

Follistatin-like 3 is a secreted glycoprotein of the follistatin-module-protein family. It may have a role in leukemogenesis. [provided by RefSeq]

Alternate Names

Follistatin-like 3, FSTL3

Gene Symbol

FSTL3

UniProt

Additional Follistatin-related Gene Protein/FLRG Products

Product Documents for Follistatin-related Gene Protein/FLRG/Fstl3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Follistatin-related Gene Protein/FLRG/Fstl3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Follistatin-related Gene Protein/FLRG/Fstl3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Follistatin-related Gene Protein/FLRG/Fstl3 Antibody - BSA Free and earn rewards!

Have you used Follistatin-related Gene Protein/FLRG/Fstl3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...