gamma Tubulin Antibody (5R3N3)

Novus Biologicals | Catalog # NBP3-16852

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5R3N3 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 231-451 of human gamma Tubulin (P23258). LVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for gamma Tubulin Antibody (5R3N3)

Western Blot: gamma Tubulin Antibody (5R3N3) [NBP3-16852]

Western Blot: gamma Tubulin Antibody (5R3N3) [NBP3-16852]

Western Blot: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Western blot analysis of extracts of various cell lines, using gamma Tubulin Rabbit mAb (NBP3-16852) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Immunohistochemistry-Paraffin: gamma Tubulin Antibody (5R3N3) [NBP3-16852]

Immunohistochemistry-Paraffin: gamma Tubulin Antibody (5R3N3) [NBP3-16852]

Immunohistochemistry-Paraffin: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Immunohistochemistry of paraffin-embedded mouse testis using gamma Tubulin Rabbit mAb (NBP3-16852) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: gamma Tubulin Antibody (5R3N3) [NBP3-16852]

Immunohistochemistry-Paraffin: gamma Tubulin Antibody (5R3N3) [NBP3-16852]

Immunohistochemistry-Paraffin: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Immunohistochemistry of paraffin-embedded rat testis using gamma Tubulin Rabbit mAb (NBP3-16852) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: gamma Tubulin Antibody (5R3N3) [NBP3-16852]

Immunohistochemistry-Paraffin: gamma Tubulin Antibody (5R3N3) [NBP3-16852]

Immunohistochemistry-Paraffin: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Immunohistochemistry of paraffin-embedded human thyroid cancer using gamma Tubulin Rabbit mAb (NBP3-16852) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
gamma Tubulin Antibody (5R3N3)

Western Blot: gamma Tubulin Antibody (5R3N3) [NBP3-16852] -

Western Blot: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Western Blot of the lysate of RM1 cells. Image from verified customer review.
gamma Tubulin Antibody (5R3N3)

Immunocytochemistry/Immunofluorescence: gamma Tubulin Antibody (5R3N3) [NBP3-16852] -

Immunocytochemistry/Immunofluorescence: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Confocal imaging of NIH-3T3 cells using gamma -Tubulin Rabbit mAb (dilution 1:100) (Red). The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb (dilution 1:100) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.
gamma Tubulin Antibody (5R3N3)

Western Blot: Rabbit gamma Tubulin mAb (5R3N3) [NBP3-16852]

Western Blot: Rabbit gamma Tubulin mAb (5R3N3) [NBP3-16852] - Western blot of the lysate of PC-3 cells. Image from a verified customer review.
gamma Tubulin Antibody (5R3N3)

Immunocytochemistry/ Immunofluorescence: gamma Tubulin Antibody (5R3N3) [NBP3-16852] -

Immunocytochemistry/ Immunofluorescence: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Confocal imaging of NIH-3T3 cells using gamma Tubulin Rabbit mAb. The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb (Green). DAPI was used for nuclear staining (blue). Objective: 60x.
gamma Tubulin Antibody (5R3N3)

Immunocytochemistry/ Immunofluorescence: gamma Tubulin Antibody (5R3N3) [NBP3-16852] -

Immunocytochemistry/ Immunofluorescence: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Confocal imaging of U-2OS cells using gamma Tubulin Rabbit mAb (Green). The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb. DAPI was used for nuclear staining (blue). Objective: 60x.

Applications for gamma Tubulin Antibody (5R3N3)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:100 - 1:1000

Immunohistochemistry

1:200 - 1:2000

Immunohistochemistry-Paraffin

1:200 - 1:2000

Western Blot

1:1000 - 1:6000

Reviewed Applications

Read 2 reviews rated 5 using NBP3-16852 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: gamma Tubulin

The gamma-tubulin (TUBG1; relative molecular weight about 48 kDa) is a minor member of tubulin family (less that 0.01% of tubulin dimer). The g-tubulin ring structures, however, serve to provide structural primer for initiation of microtubular nucleation and growth, thereby being crutial for microtubule-based cellular processes, above all for mitotic spindle formation. In animal cells, a center of microtubule organization is the centrosome composed of a pair of cylindrical centrioles surrounded by fibrous pericentriolar material containing g-tubulin. Formation of the mitotic spindle is preceded by duplication of centrosome during S phase. Before mitosis, both centrosomes increase their microtubule nucleation capacity and form two microtuble asters that are pushed apart from each other by the forces of motor proteins associated at the microtubule surface.

Long Name

Tubulin gamma-1 chain

Alternate Names

Gamma-1-tubulin, GCP-1, TUBG, TUBG1

Gene Symbol

TUBG1

Additional gamma Tubulin Products

Product Documents for gamma Tubulin Antibody (5R3N3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for gamma Tubulin Antibody (5R3N3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for gamma Tubulin Antibody (5R3N3) (2)

5 out of 5
2 Customer Ratings
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used gamma Tubulin Antibody (5R3N3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 22 reviews Showing All
Filter By:
  • gamma Tubulin Antibody (5R3N3)
    Name: Armen Petrosyan
    Application: Western Blot
    Sample Tested: PC-3 human prostate cancer cell line
    Species: Human
    Verified Customer | Posted 11/19/2024
    W-B of the lysate of PC-3 cells
    gamma Tubulin Antibody (5R3N3) NBP3-16852
  • gamma Tubulin Antibody (5R3N3)
    Name: Armen Petrosyan
    Application: Western Blot
    Sample Tested: Murine prostate cancer cell line RM1
    Species: Mouse
    Verified Customer | Posted 06/27/2023
    W-B of the lysate of RM1 cells
    gamma Tubulin Antibody (5R3N3) NBP3-16852

There are no reviews that match your criteria.

Showing  1 - 22 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...