gamma Tubulin Antibody (5R3N3)
Novus Biologicals | Catalog # NBP3-16852
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 5R3N3 expressed in HEK293
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 231-451 of human gamma Tubulin (P23258). LVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for gamma Tubulin Antibody (5R3N3)
Western Blot: gamma Tubulin Antibody (5R3N3) [NBP3-16852]
Western Blot: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Western blot analysis of extracts of various cell lines, using gamma Tubulin Rabbit mAb (NBP3-16852) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.Immunohistochemistry-Paraffin: gamma Tubulin Antibody (5R3N3) [NBP3-16852]
Immunohistochemistry-Paraffin: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Immunohistochemistry of paraffin-embedded mouse testis using gamma Tubulin Rabbit mAb (NBP3-16852) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.Immunohistochemistry-Paraffin: gamma Tubulin Antibody (5R3N3) [NBP3-16852]
Immunohistochemistry-Paraffin: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Immunohistochemistry of paraffin-embedded rat testis using gamma Tubulin Rabbit mAb (NBP3-16852) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.Immunohistochemistry-Paraffin: gamma Tubulin Antibody (5R3N3) [NBP3-16852]
Immunohistochemistry-Paraffin: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Immunohistochemistry of paraffin-embedded human thyroid cancer using gamma Tubulin Rabbit mAb (NBP3-16852) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.Western Blot: gamma Tubulin Antibody (5R3N3) [NBP3-16852] -
Western Blot: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Western Blot of the lysate of RM1 cells. Image from verified customer review.Immunocytochemistry/Immunofluorescence: gamma Tubulin Antibody (5R3N3) [NBP3-16852] -
Immunocytochemistry/Immunofluorescence: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Confocal imaging of NIH-3T3 cells using gamma -Tubulin Rabbit mAb (dilution 1:100) (Red). The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb (dilution 1:100) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.Western Blot: Rabbit gamma Tubulin mAb (5R3N3) [NBP3-16852]
Western Blot: Rabbit gamma Tubulin mAb (5R3N3) [NBP3-16852] - Western blot of the lysate of PC-3 cells. Image from a verified customer review.Immunocytochemistry/ Immunofluorescence: gamma Tubulin Antibody (5R3N3) [NBP3-16852] -
Immunocytochemistry/ Immunofluorescence: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Confocal imaging of NIH-3T3 cells using gamma Tubulin Rabbit mAb. The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb (Green). DAPI was used for nuclear staining (blue). Objective: 60x.Immunocytochemistry/ Immunofluorescence: gamma Tubulin Antibody (5R3N3) [NBP3-16852] -
Immunocytochemistry/ Immunofluorescence: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Confocal imaging of U-2OS cells using gamma Tubulin Rabbit mAb (Green). The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb. DAPI was used for nuclear staining (blue). Objective: 60x.Applications for gamma Tubulin Antibody (5R3N3)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Immunocytochemistry/ Immunofluorescence
1:100 - 1:1000
Immunohistochemistry
1:200 - 1:2000
Immunohistochemistry-Paraffin
1:200 - 1:2000
Western Blot
1:1000 - 1:6000
Reviewed Applications
Read 2 reviews rated 5 using NBP3-16852 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: gamma Tubulin
Long Name
Tubulin gamma-1 chain
Alternate Names
Gamma-1-tubulin, GCP-1, TUBG, TUBG1
Gene Symbol
TUBG1
Additional gamma Tubulin Products
Product Documents for gamma Tubulin Antibody (5R3N3)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for gamma Tubulin Antibody (5R3N3)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for gamma Tubulin Antibody (5R3N3) (2)
5 out of 5
2 Customer Ratings
Have you used gamma Tubulin Antibody (5R3N3)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
2 的
2 reviews
Showing All
Filter By:
-
Application: Western BlotSample Tested: PC-3 human prostate cancer cell lineSpecies: HumanVerified Customer | Posted 11/19/2024W-B of the lysate of PC-3 cells
-
Application: Western BlotSample Tested: Murine prostate cancer cell line RM1Species: MouseVerified Customer | Posted 06/27/2023W-B of the lysate of RM1 cells
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...