GAS41 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38243

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-227 of human GAS41 (NP_006521.1).

Sequence:
MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GAS41 Antibody - BSA Free

GAS41 Antibody

Immunocytochemistry/ Immunofluorescence: GAS41 Antibody [NBP3-38243] -

Immunocytochemistry/ Immunofluorescence: GAS41 Antibody [NBP3-38243] - Immunofluorescence analysis of A-549 cells using GAS41 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
GAS41 Antibody

Immunohistochemistry: GAS41 Antibody [NBP3-38243] -

Immunohistochemistry: GAS41 Antibody [NBP3-38243] - Immunohistochemistry analysis of paraffin-embedded Rat lung using GAS41 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
GAS41 Antibody

Western Blot: GAS41 Antibody [NBP3-38243] -

Western Blot: GAS41 Antibody [NBP3-38243] - Western blot analysis of lysates from 293T cells, using GAS41 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 180s.
GAS41 Antibody

Immunohistochemistry: GAS41 Antibody [NBP3-38243] -

Immunohistochemistry: GAS41 Antibody [NBP3-38243] - Immunohistochemistry analysis of paraffin-embedded Mouse lung using GAS41 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
GAS41 Antibody

Immunocytochemistry/ Immunofluorescence: GAS41 Antibody [NBP3-38243] -

Immunocytochemistry/ Immunofluorescence: GAS41 Antibody [NBP3-38243] - Immunofluorescence analysis of HeLa cells using GAS41 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
GAS41 Antibody

Immunohistochemistry: GAS41 Antibody [NBP3-38243] -

Immunohistochemistry: GAS41 Antibody [NBP3-38243] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using GAS41 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
GAS41 Antibody

Immunocytochemistry/ Immunofluorescence: GAS41 Antibody [NBP3-38243] -

Immunocytochemistry/ Immunofluorescence: GAS41 Antibody [NBP3-38243] - Immunofluorescence analysis of U2OS cells using GAS41 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for GAS41 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GAS41

GAS41 is encoded by this gene is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors.

Alternate Names

B230215M10Rik, Gas41,4930573H17Rik, GAS41glioma-amplified sequence-41, Glioma-amplified sequence 41, nuBI1, NuBI-1, NuMA binding protein 1, NuMA-binding protein 1, YAF9, YEATS domain containing 4, YEATS domain-containing protein 4

Gene Symbol

YEATS4

Additional GAS41 Products

Product Documents for GAS41 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GAS41 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GAS41 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GAS41 Antibody - BSA Free and earn rewards!

Have you used GAS41 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...