GCDH Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48549

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GCDH Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SRPEFDWQDPLVLEEQLTTDEILIRDTFRTYCQERLMPRILLANRNEVFHREIISEMGELGVLGPTIKGYGCAGV

Reactivity Notes

Mouse (87%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GCDH Antibody - BSA Free

Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549]

Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549]

Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549] - Analysis in human liver and testis tissues using NBP2-48549 antibody. Corresponding GCDH RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549]

Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549]

Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549] - Staining of human kidney, liver, pancreas and testis using Anti-GCDH antibody NBP2-48549 (A) shows similar protein distribution across tissues to independent antibody NBP2-48907 (B).
Western Blot: GCDH Antibody [NBP2-48549]

Western Blot: GCDH Antibody [NBP2-48549]

Western Blot: GCDH Antibody [NBP2-48549] - Analysis using Anti-GCDH antibody NBP2-48549 (A) shows similar pattern to independent antibody NBP2-48907 (B).
Immunocytochemistry/ Immunofluorescence: GCDH Antibody [NBP2-48549]

Immunocytochemistry/ Immunofluorescence: GCDH Antibody [NBP2-48549]

Immunocytochemistry/Immunofluorescence: GCDH Antibody [NBP2-48549] - Staining of human cell line U-2 OS shows positivity in mitochondria.
Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549]

Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549]

Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549] - Staining of human testis shows moderate granular cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549]

Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549]

Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549]

Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549]

Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549] - Staining of human pancreas shows moderate granular cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549]

Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549]

Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549] - Staining of human testis shows weak granular cytoplasmic positivity.
Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549]

Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549]

Immunohistochemistry-Paraffin: GCDH Antibody [NBP2-48549] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Applications for GCDH Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GCDH

GCDH is encoded by this gene belongs to the acyl-CoA dehydrogenase family. It catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and CO(2) in the degradative pathway of L-lysine, L-hydroxylysine, and L-tryptophan metabolism. It uses electron transfer flavoprotein as its electron acceptor. The enzyme exists in the mitochondrial matrix as a homotetramer of 45-kD subunits. Alternatively spliced transcript variants encoding different isoforms have been identified.

Alternate Names

ACAD5, EC 1.3.99, EC 1.3.99.7, GCD, glutaryl-CoA dehydrogenase, glutaryl-CoA dehydrogenase, mitochondrial, glutaryl-Coenzyme A dehydrogenase

Gene Symbol

GCDH

Additional GCDH Products

Product Documents for GCDH Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GCDH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GCDH Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GCDH Antibody - BSA Free and earn rewards!

Have you used GCDH Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies