GFM1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38121

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 482-751 of human GFM1 (NP_079272.4).

Sequence:
VYFDTENKETVISGMGELHLEIYAQRLEREYGCPCITGKPKVAFRETITAPVPFDFTHKKQSGGAGQYGKVIGVLEPLDPEDYTKLEFSDETFGSNIPKQFVPAVEKGFLDACEKGPLSGHKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALANATLCILEPIMAVEVVAPNEFQGQVIAGINRRHGVITGQDGVEDYFTLYADVPLNDMFGYSTELRSCTEGKGEYTMEYSRYQPCLPSTQEDVINKYLEATGQLPVKKGKAKN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GFM1 Antibody - BSA Free

GFM1 Antibody

Immunohistochemistry: GFM1 Antibody [NBP3-38121] -

Immunohistochemistry: GFM1 Antibody [NBP3-38121] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using GFM1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
GFM1 Antibody

Immunohistochemistry: GFM1 Antibody [NBP3-38121] -

Immunohistochemistry: GFM1 Antibody [NBP3-38121] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using GFM1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
GFM1 Antibody

Western Blot: GFM1 Antibody [NBP3-38121] -

Western Blot: GFM1 Antibody [NBP3-38121] - Western blot analysis of various lysates, using GFM1 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 45s.

Applications for GFM1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GFM1

The GFM1 gene codes for a mitochondrial translation elongation factor G where one isoform is 751 amino acids long at around 83 kDA and another isoform is 770 amino acids in length at around 86 kDA. Mitochondrial translation is critical for maintaining mitochondrial function. Mutations may lead to a failure of the respiratory chain-oxidative phosphorylation system and maintenance of mitochondrial DNA will not be successful. GFM1 has been studied in relation to candidiasis, malaria, mycobacterium tuberculosis, hemophilia B, pneumonia, and combined oxidative phosphorylation deficiency. It interacts with TRIM63, SLX4, PRPF4, TRIM55, and SMURF2 to participate in protein biosynthesis and polypeptide chain elongation.

Alternate Names

EFG, EFG1FLJ12662, EFGM, EF-Gmt, EGF1, FLJ13632, FLJ20773, G elongation factor, mitochondrial 1, G translation elongation factor, mitochondrial, GFMCOXPD1, hEFG1, mEF-G 1, mitochondrial, mitochondrial elongation factor G, mitochondrial elongation factor G1

Gene Symbol

GFM1

Additional GFM1 Products

Product Documents for GFM1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GFM1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GFM1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GFM1 Antibody - BSA Free and earn rewards!

Have you used GFM1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...