Glutaredoxin 1/GLRX1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55346

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IQDYLQQLTGARTVPRVFIGKDCIGGCSDLVS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glutaredoxin 1/GLRX1 Antibody - BSA Free

Western Blot: Glutaredoxin 1/GLRX1 Antibody [NBP2-55346]

Western Blot: Glutaredoxin 1/GLRX1 Antibody [NBP2-55346]

Western Blot: Glutaredoxin 1/GLRX1 Antibody [NBP2-55346] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: Glutaredoxin 1/GLRX1 Antibody [NBP2-55346]

Immunohistochemistry-Paraffin: Glutaredoxin 1/GLRX1 Antibody [NBP2-55346]

Immunohistochemistry-Paraffin: Glutaredoxin 1/GLRX1 Antibody [NBP2-55346] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.
Glutaredoxin 1/GLRX1 Antibody - BSA Free

Western Blot: Glutaredoxin 1/GLRX1 Antibody - BSA Free [NBP2-55346] -

mRNA (A) and protein levels (B) of TRX1 and GLRX1 in control fibroblasts after RSL-3 treatment. A representative Western blot of TRX1 and GLRX1 is also reported. Values are expressed as mean +/- SEM. Statistical analyses were performed by ANOVA and significance was defined as *p < 0.05, **p < 0.01, ***p < 0.001 and ****p < 0.0001 respect to controls. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40308559), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Glutaredoxin 1/GLRX1 Antibody - BSA Free

Western Blot: Glutaredoxin 1/GLRX1 Antibody - BSA Free [NBP2-55346] -

mRNA (A,B) and protein (C,D) levels of TRX1 and GLRX1 in n.3 FRDA fibroblasts and n.3 control subjects, as determined by qRT-PCR and Western blot analysis, respectively. (E) Representative Western blot of TRX1, GLRX1, and GAPDH (as loading control). Data are expressed as mean +/- SEM. Statistical significance was determined by Student’s t test and defined as *p < 0.05, **p < 0.01, ***p < 0.001 respect to controls. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40308559), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Glutaredoxin 1/GLRX1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glutaredoxin 1/GLRX1

Glutaredoxins (e.g., GLRX; MIM 600443) are a family of glutathione-dependent hydrogen donors that participate in avariety of cellular redox reactions.(supplied by OMIM)

Alternate Names

GLRX, Thioltransferase

Gene Symbol

GLRX

Additional Glutaredoxin 1/GLRX1 Products

Product Documents for Glutaredoxin 1/GLRX1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glutaredoxin 1/GLRX1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Glutaredoxin 1/GLRX1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glutaredoxin 1/GLRX1 Antibody - BSA Free and earn rewards!

Have you used Glutaredoxin 1/GLRX1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...