Glutathione Peroxidase 4/GPX4 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-54979
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human
Predicted:
Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin
Cited:
Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHY
Reactivity Notes
Use in Human reported in scientific literature (PMID:33707434).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Glutathione Peroxidase 4/GPX4 Antibody - BSA Free
Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979]
Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] - Staining in human testis and pancreas tissues using anti-GPX4 antibody. Corresponding GPX4 RNA-seq data are presented for the same tissues.Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979]
Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] - Staining of human testis shows high expression.Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979]
Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] - Staining of human pancreas shows low expression as expected.Immunohistochemistry: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] -
nbp2-54979_rabbit-polyclonal-glutathione-peroxidase-4-gpx4-antibody-20920231412570.jpgImmunohistochemistry: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] -
Immunohistochemistry: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] - Cyst(e)ine promotes GPX4 protein synthesis partly through Rag-mTORC1-4EBP signaling. i WB analysis of protein expression in control (sgCon) & 4EBP1/2-double-knockout (DKO-1 & DKO-2) UMRC6 cells. Image collected & cropped by CiteAb from following publication (https://pubmed.ncbi.nlm.nih.gov/33707434), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] -
Immunohistochemistry: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] - mTORC1 inhibition sensitizes cancer cells or tumors to ferroptosis.a UMRC6 cells were treated with 1 μM RSL3 (or 1 μM ML162), or 1 μM Torin1, or both combined with or without 5 μM Ferrostatin-1 (Ferr-1) or 100 μM deferoxamine (DFO) for 6 h. Then lipid peroxidation was assessed using BODIPY™ 581/591 C11 staining followed by FACS analysis. b Bar graph showing the viability of UMRC6 cells treated with drugs using indicated combination. Concentration of each drug is described as follows. RSL3, 1 μM; ML162, 1 μM; Torin1, 1 μM; Ferr-1, 5 μM; DFO, 100 μM. n = 3. c Bar graph showing the viability of indicated cells treated with 300 nM RSL3, or 1 μM Torin1, or both for 8 h. n = 5. d Bar graph showing the viability of indicated cells treated with 300 nM ML162, or 1 μM Torin1, or both for 8 h. n = 5. e Bar graph showing the viability of indicated cells treated with different concentrations of cystine for 48 h. n = 4. f Plot showing the viability of indicated cells treated with different concentrations of erastin for 36 h. n = 4. g Volumes of PDX tumors in mice treated daily with 30 mg/kg IKE, or 10 mg/kg AZD8055, or both at different time points as shown. n = 5 mice per group. h Percentages of P-4EBP1-, GPX4-, or 4-HNE-positive stained cells per field. n = 5 randomly selected high-power fields per group. i Haematoxylin & eosin & immunohistochemical staining of PDX tumor samples collected from mice at the end of treatments described in g. For all panels, error bars are mean ± SD. If not otherwise specified, n indicates biologically independent repeats. P value was determined by two-tailed unpaired Student’s t test. For f & g, p value was determined by two-way ANOVA test. Source data are provided as a Source Data file. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33707434), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for Glutathione Peroxidase 4/GPX4 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Glutathione Peroxidase 4/GPX4
Alternate Names
GPX4, PHGPx, snGPx
Gene Symbol
GPX4
Additional Glutathione Peroxidase 4/GPX4 Products
Product Documents for Glutathione Peroxidase 4/GPX4 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Glutathione Peroxidase 4/GPX4 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Glutathione Peroxidase 4/GPX4 Antibody - BSA Free
Customer Reviews for Glutathione Peroxidase 4/GPX4 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Glutathione Peroxidase 4/GPX4 Antibody - BSA Free and earn rewards!
Have you used Glutathione Peroxidase 4/GPX4 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...