Glutathione S-Transferase pi 1/GSTP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84747

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Rat (90%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLS

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glutathione S-Transferase pi 1/GSTP1 Antibody - BSA Free

Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747]

Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747]

Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747] - Analysis using Anti-GSTP1 antibody NBP1-84747 (A) shows similar pattern to independent antibody NBP1-84748 (B).
Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747]

Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747]

Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747] - Staining of human kidney.
Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747]

Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747]

Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747] - Staining of human kidney, liver, testis and urinary bladder using Anti-GSTP1 antibody NBP1-84747 (A) shows similar protein distribution across tissues to independent antibody NBP1-84748 (B).
Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747]

Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747]

Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747] - Staining of human urinary bladder.
Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747]

Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747]

Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747] - Staining of human liver.
Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747]

Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747]

Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747] - Staining of human testis.
Glutathione S-Transferase pi 1/GSTP1 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747]

Immunocytochemistry/ Immunofluorescence: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84747]

Staining of human cell line U-2 OS shows localization to cytosol & mitochondria.

Applications for Glutathione S-Transferase pi 1/GSTP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000-1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glutathione S-Transferase pi 1/GSTP1

GSTP1 (glutathione-S-transferase, pi 1), also called GST3/DFN7, which is located on chromosome 11q13, is a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. GSTP1 act like a tumor suppressor gene, which when inactivated leads to tumor growth, and the -class glutathione S-transferase is commonly inactivated by somatic CpGisland hypermethylation in cancers of the prostate, liver, and breast. Methylation of regulatory sequences at the GSTP1 gene locus is found in the vast majority (>90%) of prostate carcinomas and is associated with transcriptional down-regulation.

Alternate Names

DFN7, FAEES3, Glutathione STransferase pi 1, GSTP1

Gene Symbol

GSTP1

Additional Glutathione S-Transferase pi 1/GSTP1 Products

Product Documents for Glutathione S-Transferase pi 1/GSTP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glutathione S-Transferase pi 1/GSTP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Glutathione S-Transferase pi 1/GSTP1 Antibody - BSA Free

Customer Reviews for Glutathione S-Transferase pi 1/GSTP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glutathione S-Transferase pi 1/GSTP1 Antibody - BSA Free and earn rewards!

Have you used Glutathione S-Transferase pi 1/GSTP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...