GOLGA5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83352

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEGQEESSKENVSSNAACPDHTPTPNDDGKSHELSNLRLENQLLRNEVQSLNQEMASLLQRSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKV

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:31628189).

Marker

Golgi Apparatus Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GOLGA5 Antibody - BSA Free

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining in human epididymis and skeletal muscle tissues using NBP1-83352 antibody. Corresponding GOLGA5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human cerebellum, epididymis, stomach and testis using Anti-GOLGA5 antibody NBP1-83352 (A) shows similar protein distribution across tissues to independent antibody NBP2-39007 (B).
Immunocytochemistry/ Immunofluorescence: GOLGA5 Antibody [NBP1-83352]

Immunocytochemistry/ Immunofluorescence: GOLGA5 Antibody [NBP1-83352]

Immunocytochemistry/Immunofluorescence: GOLGA5 Antibody [NBP1-83352] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry: GOLGA5 Antibody [NBP1-83352] - Staining of mouse motor cortex shows strong cytoplasmic immunoreactivity in neurons.
Immunohistochemistry: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry: GOLGA5 Antibody [NBP1-83352] - Staining of mouse thalamus shows positivity in neuronal cell bodies in ventral anterior nucleus.
Immunohistochemistry: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry: GOLGA5 Antibody [NBP1-83352] - Staining of mouse hippocampus shows immunoreactivity in a subset of neurons in the CA3 area.
Immunohistochemistry: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry: GOLGA5 Antibody [NBP1-83352] - Staining of mouse mesencephalic reticular formation shows strong immunoreactivity in a subset of neurons.
Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human cerebellum shows moderate granular cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human epididymis shows strong positivity in Golgi apparatus in glandular cells.
Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human stomach shows moderate to strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352]

Immunohistochemistry-Paraffin: GOLGA5 Antibody [NBP1-83352] - Staining of human testis shows moderate to strong granular cytoplasmic positivity in cells in seminiferous ducts.
GOLGA5 Antibody - BSA Free Western Blot: GOLGA5 Antibody - BSA Free [NBP1-83352]

Western Blot: GOLGA5 Antibody - BSA Free [NBP1-83352]

Analysis in U-87MG ATCC cells) transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GOLGA5 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
GOLGA5 Antibody - BSA Free Immunohistochemistry-Paraffin: GOLGA5 Antibody - BSA Free [NBP1-83352]

Immunohistochemistry-Paraffin: GOLGA5 Antibody - BSA Free [NBP1-83352]

Staining of mouse globus pallidus shows positivity in neuronal cell bodies.
GOLGA5 Antibody - BSA Free

Western Blot: GOLGA5 Antibody - BSA Free [NBP1-83352] -

Hep-EVs reveals enhanced release with proliferative information during liver regeneration. (A) Flow cytometric analysis showing ASGPR surface expression on LT-EVs before and after immunomagnetic sorting. (B) Size distribution of LT-EVs analyzed by NTA. (C) Quantification of particle number of LT-EVs by NTA and protein amount of LT-EVs determined by the BCA assay. Mean +/- SD. n = 3 per group. *, p < 0.05; ***, p < 0.001; one-way ANOVA with Turkey’s post-hoc tests. (D) Representative TEM image of LT-EVs from Sham and PHx livers. Bars = 250 nm. (E) Size distribution of sorted Hep-EVs analyzed by NTA. (F) Quantification of particle number of sorted Hep-EVs by NTA and protein amount determined by the BCA assay. Mean +/- SD. n = 3 per group. ***, p < 0.001; ****, p < 0.0001; one-way ANOVA with Turkey’s post-hoc tests. (G) Venn diagram of proteome of PHx and Sham Hep-EVs. (H) Volcano plot of proteome of PHx and Sham Hep-EVs. (I) GO terms in the Cellular Component category of DEPs enriched in PHx over Sham Hep-EVs. (J) Western blot analysis of protein marker expression of LT-EVs and Hep-EVs. (K) Top-ranked DEPs of interest in Hep-EVs and Western blot validation of expression Image collected and cropped by CiteAb from the following open publication (https://jnanobiotechnology.biomedcentral.com/articles/10.1186/s12951-02…), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for GOLGA5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GOLGA5

The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes a member of the golgin family of proteins, whose members localize to the Golgi. This protein is a coiled-coil membrane protein that has been postulated to play a role in vesicle tethering and docking. Translocations involving this gene and the ret proto-oncogene have been found in tumor tissues; the chimeric sequences have been designated RET-II and PTC5. [provided by RefSeq]

Alternate Names

Cell proliferation-inducing gene 31 protein, golgi autoantigen, golgin subfamily a, 5, golgin A5, Golgin subfamily A member 5, golgin-84, GOLIM5, Protein Ret-II, PTC5, RET-fused gene 5 protein, RETII, ret-II, rfg5, RFG5golgi integral membrane protein 5

Gene Symbol

GOLGA5

Additional GOLGA5 Products

Product Documents for GOLGA5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GOLGA5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for GOLGA5 Antibody - BSA Free

Customer Reviews for GOLGA5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GOLGA5 Antibody - BSA Free and earn rewards!

Have you used GOLGA5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...