gp96/HSP90B1/GRP94 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81802

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse

Predicted:

Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: WSSKTETVEEPMEEEEAAKEEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTS

Marker

ER Stress Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for gp96/HSP90B1/GRP94 Antibody - BSA Free

Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802]

Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802]

Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802] - Staining in human thyroid gland and skeletal muscle tissues using NBP1-81802 antibody. Corresponding HSP90B1 RNA-seq data are presented for the same tissues.
Western Blot: gp96/HSP90B1/GRP94 Antibody [NBP1-81802]

Western Blot: gp96/HSP90B1/GRP94 Antibody [NBP1-81802]

Western Blot: gp96/HSP90B1/GRP94 Antibody [NBP1-81802] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-HSP90B1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: gp96/HSP90B1/GRP94 Antibody [NBP1-81802]

Immunocytochemistry/ Immunofluorescence: gp96/HSP90B1/GRP94 Antibody [NBP1-81802]

Immunocytochemistry/Immunofluorescence: gp96/HSP90B1/GRP94 Antibody [NBP1-81802] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Western Blot: gp96/HSP90B1/GRP94 Antibody [NBP1-81802]

Western Blot: gp96/HSP90B1/GRP94 Antibody [NBP1-81802]

Western Blot: gp96/HSP90B1/GRP94 Antibody [NBP1-81802] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802]

Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802]

Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802] - Staining of human thyroid gland shows high expression.
Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802]

Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802]

Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802]

Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802]

Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802]

Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802]

Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802]

Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802]

Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for gp96/HSP90B1/GRP94 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: gp96/HSP90B1

Glucose-regulated protein 94, also known as Grp94 or gp96, is an abundant resident endoplasmic reticulum (ER) lumenal stress protein which together with cytosolic Hsp90 belongs to the Hsp90 family of molecular chaperones. Grp94 and other resident soluble proteins of the ER such as members of the Ca(2+) binding protein subfamily (CaBP), CaBPI and CaBP2 as well as calreticulin, possess the COOH-terminal tetrapeptide Lys-Asp-Glu-Leu (KDEL) which is a sorting signal that is thought to lead to the retention of these proteins in the pre-Golgi compartments (1). Grp94 expression is upregulated by stress conditions such as lucose starvation and heat shock, which promote protein misfolding or unfolding (2). In addition to a homeostatic role in protein folding and assembly, Grp94 can function in the intracellular trafficking of peptides from the extracellular space to the MHC class I antigen processing pathway of antigen presentation cells (3,4). Grp94 and Hsp90 share high sequence identity and presumably identical adenosine nucleotide-dependent modes of regulation. Earlier data suggests that Hsp90 and Grp94 may differ in their nucleotide binding properties. The N-terminal domain of eukaryotic Hsp90 proteins contains a conserved adenosine nucleotide binding pocket which also serves as the inding site for the Hsp90 inhibitors geldanamycin and radicicol. However, the molecular basis for adenosine nucleotide-dependent regulation of Grp94remains to be established. Recent data has entified a ligand dependent regulation of Grp94 function and suggest a model whereby Grp94 function is regulated through a ligand-dependent conversion of Grp94 from an inactive to an active conformation (5, 6).

Long Name

Heat Shock Protein 90 beta 1

Alternate Names

ECGP, Endoplasmin, Grp94, HSP90B1

Gene Symbol

HSP90B1

Additional gp96/HSP90B1 Products

Product Documents for gp96/HSP90B1/GRP94 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for gp96/HSP90B1/GRP94 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for gp96/HSP90B1/GRP94 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review gp96/HSP90B1/GRP94 Antibody - BSA Free and earn rewards!

Have you used gp96/HSP90B1/GRP94 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...