GPRC5A/RAI3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89743

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GPRC5A Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPR

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GPRC5A/RAI3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: GPRC5A/RAI3 Antibody [NBP1-89743]

Immunocytochemistry/ Immunofluorescence: GPRC5A/RAI3 Antibody [NBP1-89743]

Immunocytochemistry/Immunofluorescence: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human cell line U-2 OS shows localization to nucleoli, plasma membrane & vesicles. Antibody staining is shown in green.
GPRC5A/RAI3 Antibody - BSA Free Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody - BSA Free [NBP1-89743]

Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody - BSA Free [NBP1-89743]

Analysis in human lung and skeletal muscle tissues using NBP1-89743 antibody. Corresponding GPRC5A RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743]

Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743]

Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human lung shows moderate membranous positivity in pneumocytes.
Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743]

Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743]

Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743]

Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743]

Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human small intestine shows moderate positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743]

Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743]

Immunohistochemistry-Paraffin: GPRC5A/RAI3 Antibody [NBP1-89743] - Staining of human urinary bladder shows moderate membranous positivity in urothelial cells.
Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743]

Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743]

Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - (J) RAI3 has a conspicuously low expression in BxPc3 and PaCaDD165 in comparison to the other cell lines in the group. (n = 3). (PLoS One. 2017; 12 (1): e0170390. Published online 2017 Jan 23.)
Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743]

Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743]

Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - Wester Blot: Pancreatic cell lines, where NC1 and NC2 represent negative controls.
GPRC5A/RAI3 Antibody

Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] -

Western Blot: GPRC5A/RAI3 Antibody [NBP1-89743] - Influence of GPRC5a knockout on the proliferation & migration ability in MIA PaCa-2 & TB32047 cells. (A–D) Western blot & sequencing results showing the GPRC5a knocked out in MIA PaCa-2-KO1/2 & TB32047-KO1/2 (Red highlight area means the different part in comparison of sequencing sequence). (E,F): The knockout of GPRC5a inhibited the proliferation ability of MIA PaCa-2 & TB32047 cells. (G,H) GPRC5a knockout inhibited the migration ability of MIA PaCa-2 (G) & TB32047 cells (H). * p-value < 0.05. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/29949874), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
GPRC5A/RAI3 Antibody - BSA Free Western Blot: GPRC5A/RAI3 Antibody - BSA Free [NBP1-89743]

Western Blot: GPRC5A/RAI3 Antibody - BSA Free [NBP1-89743]

Analysis in human cell lines A-431 and U-251MG using Anti-GPRC5A antibody. Corresponding GPRC5A RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

Applications for GPRC5A/RAI3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04 - 0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GPRC5A

GPRC5A is a member of the G protein-coupled receptor family, characterized by a signature 7- transmembrane domain motif. GPRC5A is a lung-specific tumor suppressor and may play a role in the interaction between retinoid acid and G protein signaling pathways. GPRC5A is also involved in embryonic development and epithelial cell differentiation.

Long Name

G Protein-coupled Receptor, Family C, Group 5, Member A

Alternate Names

RAI3, RAIG1

Gene Symbol

GPRC5A

Additional GPRC5A Products

Product Documents for GPRC5A/RAI3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GPRC5A/RAI3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers

Citations for GPRC5A/RAI3 Antibody - BSA Free

Customer Reviews for GPRC5A/RAI3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GPRC5A/RAI3 Antibody - BSA Free and earn rewards!

Have you used GPRC5A/RAI3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies