Grancalcin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89786

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ALNAWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDY

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Grancalcin Antibody - BSA Free

Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89786]

Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89786]

Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89786] - Staining of human bone marrow, cerebral cortex, kidney and liver using Anti-GCA antibody NBP1-89786 (A) shows similar protein distribution across tissues to independent antibody NBP1-89785 (B).
Grancalcin Antibody - BSA Free Immunohistochemistry-Paraffin: Grancalcin Antibody - BSA Free [NBP1-89786]

Immunohistochemistry-Paraffin: Grancalcin Antibody - BSA Free [NBP1-89786]

Analysis in human bone marrow and cerebral cortex tissues using Anti-GCA antibody. Corresponding GCA RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89786]

Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89786]

Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89786] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89786]

Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89786]

Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89786] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89786]

Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89786]

Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89786] - Staining of human kidney.
Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89786]

Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89786]

Immunohistochemistry-Paraffin: Grancalcin Antibody [NBP1-89786] - Staining of human liver.
Western Blot: Grancalcin Antibody [NBP1-89786]

Western Blot: Grancalcin Antibody [NBP1-89786]

Western Blot: Grancalcin Antibody [NBP1-89786] - Analysis using Anti-GCA antibody NBP1-89786 (A) shows similar pattern to independent antibody NBP1-89785 (B).
Grancalcin Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: Grancalcin Antibody [NBP1-89786]

Immunocytochemistry/ Immunofluorescence: Grancalcin Antibody [NBP1-89786]

Staining of human cell line A-431 shows localization to cytosol.

Applications for Grancalcin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Grancalcin

Grancalcin, is a calcium-binding protein abundant in neutrophils and macrophages. It belongs to the penta-EF-hand subfamily of proteins which includes sorcin, calpain, and ALG-2. Grancalcin localization is dependent upon calcium and magnesium. In the absence of divalent cation, grancalcin localizes to the cytosolic fraction; with magnesium alone, it partitions with the granule fraction; and in the presence of magnesium and calcium, it associates with both the granule and membrane fractions, suggesting a role for grancalcin in granule-membrane fusion and degranulation.

Alternate Names

EF-hand calcium-binding protein, grancalcin, EF-hand calcium binding protein, grancalcin, penta-EF-hand protein

Gene Symbol

GCA

Additional Grancalcin Products

Product Documents for Grancalcin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Grancalcin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Grancalcin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Grancalcin Antibody - BSA Free and earn rewards!

Have you used Grancalcin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...