GSTM3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83323

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINN

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GSTM3 Antibody - BSA Free

GSTM3 Antibody - BSA Free Immunohistochemistry-Paraffin: GSTM3 Antibody - BSA Free [NBP1-83323]

Immunohistochemistry-Paraffin: GSTM3 Antibody - BSA Free [NBP1-83323]

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
GSTM3 Antibody - BSA Free Immunohistochemistry-Paraffin: GSTM3 Antibody - BSA Free [NBP1-83323]

Immunohistochemistry-Paraffin: GSTM3 Antibody - BSA Free [NBP1-83323]

Staining of human lymph node shows no positivity in non-germinal center cells as expected.
GSTM3 Antibody - BSA Free Immunohistochemistry-Paraffin: GSTM3 Antibody - BSA Free [NBP1-83323]

Immunohistochemistry-Paraffin: GSTM3 Antibody - BSA Free [NBP1-83323]

Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.
GSTM3 Antibody - BSA Free Immunohistochemistry-Paraffin: GSTM3 Antibody - BSA Free [NBP1-83323]

Immunohistochemistry-Paraffin: GSTM3 Antibody - BSA Free [NBP1-83323]

Staining of human liver shows no positivity in hepatocytes as expected.
GSTM3 Antibody - BSA Free Immunohistochemistry-Paraffin: GSTM3 Antibody - BSA Free [NBP1-83323]

Immunohistochemistry-Paraffin: GSTM3 Antibody - BSA Free [NBP1-83323]

Analysis in human testis and liver tissues using NBP1-83323 antibody. Corresponding GSTM3 RNA-seq data are presented for the same tissues.

Applications for GSTM3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GSTM3

GSTM3, also known as Glutathione S-transferase Mu 3, is a 225 amino acid that is approx. 27 kDa; is responsible for conjugation of reduced glutathione to an extensive number of exogenous and endogenous hydrophobic electrophiles, and may be able to regulate uptake and detoxification of both endogenous compounds and xenobiotics at the testis and brain blood barriers. Current research is being performed on over 70 diseases and disorders including laryngeal squamous cell carcinoma, pharyngitis, laryngitis, squamous cell carcinoma, laryngeal cancer, oral cancer, cataract, colorectal cancer, carcinoma, breast cancer, astrocytoma, non-Hodgkin lymphoma, malignant pleural mesothelioma, open-angle glaucoma, Hodgkin's lymphoma, lung cancer, basal cell carcinoma, adult brain tumor, and leukoplakia. This protein has been shown to have interactions with over 70 proteins including RBL2, GSTM2, PAK2, MPG, and TFE3 in pathways such as glutathione metabolism, metabolism of xenobiotics by cytochrome P450, drug metabolism - cytochrome P450, establishment of blood-nerve barrier, and response to estrogen stimulus pathway.

Alternate Names

glutathione S-transferase mu 3 (brain), GST5Mu-3, MGC3310, MGC3704, S-(hydroxyalkyl)glutathione lyase M3

Gene Symbol

GSTM3

Additional GSTM3 Products

Product Documents for GSTM3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GSTM3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GSTM3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GSTM3 Antibody - BSA Free and earn rewards!

Have you used GSTM3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...