GSTO1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32691

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Biological Validation

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry-Paraffin, Western Blot

Cited:

Immunohistochemistry-Frozen, Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: WFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GSTO1 Antibody - BSA Free

Western Blot: GSTO1 Antibody [NBP2-32691]

Western Blot: GSTO1 Antibody [NBP2-32691]

Western Blot: GSTO1 Antibody [NBP2-32691] - Human breast cancer cell line MCF7 was treated with carboplatin for 72 hours and expression of GSTO1 was detected by Western blot. Image from verified customer review.
Western Blot: GSTO1 Antibody [NBP2-32691]

Western Blot: GSTO1 Antibody [NBP2-32691]

Western Blot: GSTO1 Antibody [NBP2-32691] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
GSTO1 Antibody - BSA Free Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691]

Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691]

Analysis in human liver and pancreas tissues. Corresponding RNA-seq data are presented for the same tissues.
GSTO1 Antibody - BSA Free Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691]

Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691]

Staining of human testis shows weak cytoplasmic positivity in Leydig cells as expected.
GSTO1 Antibody - BSA Free Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691]

Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691]

Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
GSTO1 Antibody - BSA Free Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691]

Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691]

Staining of human pancreas shows weak cytoplasmic positivity in exocrine glandular cells as expected.
GSTO1 Antibody - BSA Free Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691]

Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691]

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
GSTO1 Antibody - BSA Free Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691]

Immunohistochemistry-Paraffin: GSTO1 Antibody [NBP2-32691]

Staining of human kidney, liver, pancreas and testis HPA037603 (A) shows similar protein distribution across tissues to independent antibody HPA037604 (B).

Applications for GSTO1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. GSTO1 antibody validated for WB from a verified customer review.

Reviewed Applications

Read 1 review rated 4 using NBP2-32691 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GSTO1

GSTO1 encodes a member of the theta class glutathione S-transferase-like (GSTTL) protein family. In mouse, the encoded protein acts as a small stress response protein, likely involved in cellular redox homeostasis.

Alternate Names

DKFZp686H13163, EC 2.5.1.18, glutathione S-transferase omega 1, glutathione S-transferase omega 1-1, glutathione S-transferase omega-1, glutathione-S-transferase like, GSTO-1, GSTTLp28, P28

Gene Symbol

GSTO1

Additional GSTO1 Products

Product Documents for GSTO1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GSTO1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for GSTO1 Antibody - BSA Free

Customer Reviews for GSTO1 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used GSTO1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 的 1 review Showing All
Filter By:
  • GSTO1 Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: breast cancer cell line
    Species: Human Cancer Cell Lines and Human
    Verified Customer | Posted 09/21/2018
    Human breast cancer cell line MCF7 was treated by carboplatin for 72 hours and protein expression of GSTO1 was detected by western blot.
    GSTO1 Antibody - BSA Free NBP2-32691

There are no reviews that match your criteria.

Showing  1 - 1 的 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...