Guanylyl Cyclase beta 1 Antibody (5O8D9)

Novus Biologicals | Catalog # NBP3-16248

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human, Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5O8D9 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Guanylyl Cyclase beta 1 (Q02153). MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQN

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

71 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Guanylyl Cyclase beta 1 Antibody (5O8D9)

Western Blot: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248]

Western Blot: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248]

Western Blot: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248] - Analysis of extracts of various cell lines, using Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit mAb (NBP3-16248) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Guanylyl Cyclase beta 1 Antibody (5O8D9)

Immunohistochemistry: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248] -

Immunohistochemistry: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Guanylyl Cyclase beta 1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Guanylyl Cyclase beta 1 Antibody (5O8D9)

Immunohistochemistry: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248] -

Immunohistochemistry: Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Guanylyl Cyclase beta 1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Guanylyl Cyclase beta 1 Antibody (5O8D9)

Guanylyl Cyclase beta 1 Antibody (5O8D9) [NBP3-16248] -

Confocal imaging of HEL cells using Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for Guanylyl Cyclase beta 1 Antibody (5O8D9)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunocytochemistry/ Immunofluorescence

1:100 - 1:400

Immunohistochemistry

1:200 - 1:800

Immunohistochemistry-Paraffin

1:200 - 1:800

Western Blot

1:1000 - 1:6000

Reviewed Applications

Read 1 review rated 4 using NBP3-16248 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Guanylyl Cyclase beta 1

Guanylate Cyclase is an heterodimer of an alpha and a beta chain. Its enzymatic activity transforms GTP to GMP releasing a diphosphate. It binds 1 or 2 hemes per heterodimer. It is activated by nitric oxide in the presence of magnesium or manganese ions. There are two types of guanylate cyclase: soluble form and membrane-associated receptor form.

Alternate Names

EC 4.6.1.2, GC-SB3, GCS-beta-1, GCS-beta-3, guanylate cyclase 1, soluble, beta 3, guanylate cyclase soluble subunit beta-1, Guanylate cyclase soluble subunit beta-3, GUC1B3GUCB3, GUCSB3GC-S-beta-1, GUCY1B1, Soluble guanylate cyclase small subunit

Gene Symbol

GUCY1B1

Additional Guanylyl Cyclase beta 1 Products

Product Documents for Guanylyl Cyclase beta 1 Antibody (5O8D9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Guanylyl Cyclase beta 1 Antibody (5O8D9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Guanylyl Cyclase beta 1 Antibody (5O8D9)

Customer Reviews for Guanylyl Cyclase beta 1 Antibody (5O8D9) (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Guanylyl Cyclase beta 1 Antibody (5O8D9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • Guanylyl Cyclase beta 1 Antibody (5O8D9)
    Name: Sophie E
    Application: Immunohistochemistry-Paraffin
    Sample Tested: Rat Lung Tissue
    Species: Rat
    Verified Customer | Posted 06/23/2025
    Native rat lung stained for CD31 (green), DAPI (blue) and Gucy1b1 (cyan).
    Guanylyl Cyclase beta 1 Antibody (5O8D9) NBP3-16248

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...