HARS Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89490

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HARS Antibody - BSA Free

Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490]

Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490]

Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490] - Staining of human kidney shows positivity in cells in tubules.
Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490]

Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490]

Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490]

Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490]

Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490] - Staining of human skin shows positivity in epidermal cells.
Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490]

Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490]

Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490] - Staining of human cerebellum shows positivity in Purkinje cells.
HARS Antibody - BSA Free Western Blot: HARS Antibody - BSA Free [NBP1-89490]

Western Blot: HARS Antibody - BSA Free [NBP1-89490]

Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-HARS antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
HARS Antibody - BSA Free Western Blot: HARS Antibody - BSA Free [NBP1-89490]

Western Blot: HARS Antibody - BSA Free [NBP1-89490]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HARS Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: HARS Antibody - BSA Free [NBP1-89490]

Immunocytochemistry/ Immunofluorescence: HARS Antibody - BSA Free [NBP1-89490]

Staining of human cell line A-431 shows localization to cytosol.

Applications for HARS Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HARS

Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is a cytoplasmic enzyme which belongs to the class II family of aminoacyl-tRNA synthetases. The enzyme is responsible for the synthesis of histidyl-transfer RNA, which is essential for the incorporation of histidine into proteins. The gene is located in a head-to-head orientation with HARSL on chromosome five, where the homologous genes share a bidirectional promoter. The gene product is a frequent target of autoantibodies in the human autoimmune disease polymyositis/dermatomyositis.

Alternate Names

cytoplasmic, EC 6.1.1.21, FLJ20491, histidine-tRNA ligase, histidyl-tRNA synthetase, histidyl-tRNA synthetase, cytoplasmic

Gene Symbol

HARS1

Additional HARS Products

Product Documents for HARS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HARS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HARS Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HARS Antibody - BSA Free and earn rewards!

Have you used HARS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...