HCA59 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83170

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KKTEEMLSNQMLSGIPEVDLGIDAKIKNIISTEDAKARLLAEQQNKKKDSETSFVPTNMAVNYVQHNR

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23276153)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HCA59 Antibody - BSA Free

Western Blot: HCA59 Antibody [NBP1-83170]

Western Blot: HCA59 Antibody [NBP1-83170]

Western Blot: HCA59 Antibody [NBP1-83170] - Analysis using Anti-C9orf78 antibody NBP1-83170 (A) shows similar pattern to independent antibody NBP1-83168 (B).
Immunocytochemistry/ Immunofluorescence: HCA59 Antibody [NBP1-83170]

Immunocytochemistry/ Immunofluorescence: HCA59 Antibody [NBP1-83170]

Immunocytochemistry/Immunofluorescence: HCA59 Antibody [NBP1-83170] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Western Blot: HCA59 Antibody [NBP1-83170]

Western Blot: HCA59 Antibody [NBP1-83170]

Western Blot: HCA59 Antibody [NBP1-83170] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HCA59 Antibody - BSA Free Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83170]

Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83170]

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
HCA59 Antibody - BSA Free Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83170]

Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83170]

Analysis in human bone marrow and pancreas tissues. Corresponding RNA-seq data are presented for the same tissues.
HCA59 Antibody - BSA Free Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83170]

Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83170]

Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.
HCA59 Antibody - BSA Free Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83170]

Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83170]

Staining of human pancreas shows very weak positivity in exocrine glandular cells as expected.
HCA59 Antibody - BSA Free Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83170]

Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83170]

Staining of human bone marrow shows high expression.
HCA59 Antibody - BSA Free Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83170]

Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83170]

Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.
HCA59 Antibody - BSA Free Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83170]

Immunohistochemistry-Paraffin: HCA59 Antibody [NBP1-83170]

Staining of human bone marrow, fallopian tube, lymph node and testis HPA021216 (A) shows similar protein distribution across tissues to independent antibody HPA021232 (B).

Applications for HCA59 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HCA59

Alternate Names

bA409K20.3, C9orf78, chromosome 9 open reading frame 78, HCA59, Hepatocellular carcinoma-associated antigen 59, HSPC220

Gene Symbol

C9ORF78

Additional HCA59 Products

Product Documents for HCA59 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HCA59 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for HCA59 Antibody - BSA Free

Customer Reviews for HCA59 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HCA59 Antibody - BSA Free and earn rewards!

Have you used HCA59 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...