HDAC1 Antibody (2L6O7)

Novus Biologicals | Catalog # NBP3-15780

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2L6O7 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 350-450 of human HDAC1 (Q13547). MTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HDAC1 Antibody (2L6O7)

Western Blot: HDAC1 Antibody (2L6O7) [NBP3-15780]

Western Blot: HDAC1 Antibody (2L6O7) [NBP3-15780]

Western Blot: HDAC1 Antibody (2L6O7) [NBP3-15780] - Western blot analysis of extracts of various cell lines, using HDAC1 antibody (NBP3-15780) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Knockout Validated: HDAC1 Antibody (2L6O7) [NBP3-15780]

Western Blot: HDAC1 Antibody (2L6O7) [NBP3-15780]

Western Blot: HDAC1 Antibody (2L6O7) [NBP3-15780] - Western blot analysis of extracts from normal (control) and HDAC1 knockout (KO) 293T cells, using HDAC1 antibody (NBP3-15780) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
HDAC1 Antibody (2L6O7)

Immunohistochemistry: HDAC1 Antibody (2L6O7) [HDAC1] -

Immunohistochemistry: HDAC1 Antibody (2L6O7) [HDAC1] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KO Validated] HDAC1 Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
HDAC1 Antibody (2L6O7)

Immunohistochemistry: HDAC1 Antibody (2L6O7) [HDAC1] -

Immunohistochemistry: HDAC1 Antibody (2L6O7) [HDAC1] - Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using [KO Validated] HDAC1 Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
HDAC1 Antibody (2L6O7)

Immunohistochemistry: HDAC1 Antibody (2L6O7) [HDAC1] -

Immunohistochemistry: HDAC1 Antibody (2L6O7) [HDAC1] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using [KO Validated] HDAC1 Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
HDAC1 Antibody (2L6O7)

Immunocytochemistry/ Immunofluorescence: HDAC1 Antibody (2L6O7) [HDAC1] -

Immunocytochemistry/ Immunofluorescence: HDAC1 Antibody (2L6O7) [HDAC1] - Confocal imaging of HeLa cells using [KO Validated] HDAC1 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
HDAC1 Antibody (2L6O7)

Immunohistochemistry: HDAC1 Antibody (2L6O7) [HDAC1] -

Immunohistochemistry: HDAC1 Antibody (2L6O7) [HDAC1] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using [KO Validated] HDAC1 Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
HDAC1 Antibody (2L6O7)

Immunoprecipitation: HDAC1 Antibody (2L6O7) [HDAC1] -

Immunoprecipitation: HDAC1 Antibody (2L6O7) [HDAC1] - Immunoprecipitation analysis of 300ug extracts of 293T cells using 0.5ug HDAC1 antibody. Western blot was performed from the immunoprecipitate using HDAC1 antibody at a dilition of 1:1000.
HDAC1 Antibody (2L6O7)

Immunohistochemistry: HDAC1 Antibody (2L6O7) [HDAC1] -

Immunohistochemistry: HDAC1 Antibody (2L6O7) [HDAC1] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using [KO Validated] HDAC1 Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for HDAC1 Antibody (2L6O7)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Histone Deacetylase 1/HDAC1

Histone acetylation and deacetylation, catalyzed by multisubunit complexes, play a key role in the regulation of eukaryotic gene expression. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex. It also interacts with retinoblastoma tumor-suppressor protein and this complex is a key element in the control of cell proliferation and differentiation. Together with metastasis-associated protein-2, it deacetylates p53 and modulates its effect on cell growth and apoptosis.

Long Name

Histone Deacetylase 1

Alternate Names

GON-10, HD1, KDAC1, RPD3L1

Gene Symbol

HDAC1

Additional Histone Deacetylase 1/HDAC1 Products

Product Documents for HDAC1 Antibody (2L6O7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HDAC1 Antibody (2L6O7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for HDAC1 Antibody (2L6O7)

There are currently no reviews for this product. Be the first to review HDAC1 Antibody (2L6O7) and earn rewards!

Have you used HDAC1 Antibody (2L6O7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...